KEGG   Legionella sainthelensi: CAB17_00790Help
Entry
CAB17_00790       CDS       T05293                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
lsh  Legionella sainthelensi
Pathway
lsh00500  Starch and sucrose metabolism
lsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CAB17_00790
Enzymes [BR:lsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CAB17_00790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 Complex1_LYR_2
Motif
Other DBs
NCBI-ProteinID: AUH70750
UniProt: A0A2H5FGS0
LinkDB All DBs
Position
168218..169462
Genome map
AA seq 414 aa AA seqDB search
MSSVFSLEEVQKLKQHFFSNIQSNGAIVASPSKQNPNYYYDWVRDSAIAMNLIETWYEST
HAYGYKERLLHYVDWTQILQHQNNPNYGYDILGEPKFYINGYPFNEQWGRPQNDGPALRA
SVLIHFAQQLLDNHETEYVKTRLYNSTMDPHSMGAIKMDLEYIAHHWPDPNYDLWEEVYG
DHFFTAMAQQKALLEGATLARRLNDNSAAVYYEQQAQQIDSRLRRHLDKEHQIIQATLLP
HTGPQKTLELDSAVILGVLLNPQKNGAFSPNSLYVQNTVQALHEQFNLMFPINHNHPSAI
LFGRYPGDTYDGYQTNSIGNPWFILTATMAEYYYTLANNSSMIEDNRSQIAEYIQAGDNY
LKLIKKYAPDMKLSEQINLNTGVQQGASSLTWSYVAVLHAIDYREKLANKFNSN
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagctctgtctttagcctggaagaagtacaaaagttaaagcaacactttttctctaac
attcagtctaacggtgcaatagtagcttcaccctcaaagcaaaatcctaattattattac
gattgggtaagagattctgcaattgcgatgaatttaattgaaacatggtacgagtcaact
catgcatatgggtataaagaacgtttattgcactatgtggattggacacaaatacttcaa
catcaaaataatccaaattacggatacgatatattgggagaacccaaattttatattaat
ggctacccttttaatgaacaatggggaagacctcagaatgatggccccgctttgagagct
tcggtattgattcattttgcacaacagttactagacaatcatgaaactgaatatgttaaa
actcgtttatataatagcactatggatcctcatagcatgggtgcgattaaaatggatttg
gaatacatagcgcatcattggccagaccccaattatgatctttgggaagaggtttatgga
gatcatttttttactgcgatggcacaacaaaaagcgctcctcgaaggagcaactcttgct
cgccgtctgaatgataatagtgctgctgtgtattatgagcagcaagcacaacaaatagac
tcccgtcttcgccgacatttagataaggagcatcaaatcattcaagcaactcttttacct
catacaggccctcaaaaaacattagagcttgattctgcagtaattcttggtgttctattg
aatccacaaaaaaatggggctttctcgcctaacagcctctatgttcaaaatacagtccaa
gccttacatgaacaattcaatttaatgtttcccattaaccataatcatcctagcgctatt
ttatttggccgttatcctggggatacttatgacggatatcaaacaaacagtatagggaat
ccctggtttattttaacggcaacaatggctgagtactattataccctggctaataactca
tcgatgatagaggacaatcgatctcaaatagcagaatacattcaagcaggtgataattac
ttaaagctcataaaaaaatatgcgccagatatgaaattaagtgaacaaattaacttaaat
actggagttcaacaaggagcatcatcccttacctggagttatgtagctgttttacacgcg
attgattatagagaaaaattagcaaataaatttaattccaattaa

DBGET integrated database retrieval system