KEGG   Legionella sainthelensi: CAB17_01295Help
Entry
CAB17_01295       CDS       T05293                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lsh  Legionella sainthelensi
Pathway
lsh00620  Pyruvate metabolism
lsh00680  Methane metabolism
lsh01100  Metabolic pathways
lsh01120  Microbial metabolism in diverse environments
lsh01200  Carbon metabolism
Module
lsh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CAB17_01295
  09102 Energy metabolism
   00680 Methane metabolism
    CAB17_01295
Enzymes [BR:lsh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CAB17_01295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AUH70832
UniProt: A0A2H5FH04
LinkDB All DBs
Position
269294..271609
Genome map
AA seq 771 aa AA seqDB search
MNQNVSHLPRELSHMVSWSLTRLGKTIAEVYGKETYEIIEQIRVSMQDTIGSKALELRNA
LLKLQIELSKLDKNQLYQIAHGFSLMMELINACESAYRIFRINQRKEKVYSDKPQGIHYV
LTAHPTEARTNEFLILFKAIRDFLIEVLKSPYLMNESHLDQMLKISLQINISPHKKPSVE
DEARYIYQYALNPLNIELYHSFFTKGVPIQLRTWVGGDKDGHSGVNEKIMVKSLELSRSF
FVAYIQECLKEVLEIVKLSTGLNANKILANQINQLIRKTLDLRKIKPRDHEKVSAFKNEL
TAIQAHTLKFLHFNLEQFSIISSIFQLYPALVIPIELREDSAVVRESLTSIKKSTITNML
EQVYFITHGTDPKNYIRGFILSMVESAEDIKNGIKLVKQVFRSYALPVVPLFENQLALTN
ADSILNNSITEDIREKHLKQWDGNYEVMLGYSDSSKENGVLLSRLMIARSLRSIQSTLEK
KNLRPIFFHGSGGSIERGGGDIKEQTASWSKEMMANYKATIQGEMVARLFGSSSILKSQI
DKFLDIYSQQVKKTDNDYPEELLLFATEISQKYKTLIKSEWFWSVIEQASPYHFLKELKI
GSRPTKRKSGPDQRKLRAIPWILCWTQTRLLFPTWWGVGSTWLELNDLGKNKLKALYQEN
AFFASFVKQLGVTLSKVYLPIWEQYLYQLTGSNQYLEPFQSELESTILFFYQITGEKDFC
FHQPWLGESIQLRSTMVHPLNLIQIEAIKRKDLPLLRKTVTGISCGMLTTG
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaatgtctctcatctgccaagagaactcagtcatatggtttcttggtccctt
actcgtttagggaagaccattgctgaagtttatggaaaagaaacatacgaaataattgaa
caaattcgagtatccatgcaagacaccattgggagtaaagcactcgaacttagaaatgcg
cttcttaagctccaaattgaactttctaagttggataaaaatcagctttatcaaattgct
cacgggttttctctcatgatggaactcattaatgcgtgtgaaagtgcttaccgcattttt
cgtatcaaccaaagaaaagaaaaagtctactctgacaaaccgcaaggcattcattatgtt
ttaacagcccacccaactgaagctcgcaccaatgaatttctaatacttttcaaagcaatt
cgtgattttcttatcgaggtgcttaaatctccatatctgatgaatgaatctcatttggat
caaatgcttaaaatctcactccaaattaatatttccccacataaaaaaccaagcgtagaa
gacgaagctcgatacatctatcaatatgcactcaatcctctcaacatcgaactttatcat
tcctttttcaccaaaggtgttcctattcaattacgcacctgggtaggaggggataaagat
gggcattcgggtgttaatgaaaaaataatggttaaaagtctcgaactctctcgatctttt
tttgttgcctacattcaggagtgcttaaaagaagtgctcgaaattgtcaaactctcaacc
ggattgaatgcaaacaaaattttggcaaatcagatcaatcaacttattagaaaaacactt
gaccttagaaaaataaaaccgagggatcatgaaaaagtttctgcgttcaaaaatgaatta
actgcaatacaagcacacaccctaaagtttttacattttaatctcgaacaattctcaatt
atttccagcatttttcagctttatcctgccttagtcatacccatagaacttagagaggat
tcagccgtcgtaagagaaagtttaaccagcatcaaaaaaagcacgatcaccaatatgctt
gaacaagtctattttataacccatggaactgatcccaaaaactatatacgcggttttatt
ctcagtatggttgaatctgctgaggatataaaaaacgggattaaattagtgaaacaagtt
tttaggagttacgctctacctgttgtacccttatttgaaaatcagcttgcgctcaccaat
gctgattccattttaaataattccatcacggaagatattagagagaagcatcttaagcaa
tgggatggcaactatgaggtcatgctgggttactccgactcctctaaagaaaatggcgta
ttgctttctcggctcatgattgccagaagcttaagaagtattcaatccacgctagagaaa
aaaaacctgcgacccattttttttcatggctcgggtggcagcattgagagaggcggtggc
gacatcaaagaacaaaccgcttcttggtccaaagaaatgatggcgaattataaagcaacg
attcagggagaaatggttgcacgactctttggatcgagctctatactcaaaagtcaaatt
gacaaatttcttgatatttattcacaacaggtaaaaaaaacggataatgattatcctgag
gaactgttattatttgctacagaaatcagccaaaaatataaaaccctgataaaaagtgaa
tggttttggtcagtaatcgaacaagcatcaccctatcattttttgaaagaacttaagatt
ggctctcgtccaaccaaacgaaagtcaggaccggatcaaagaaaacttcgtgccatccca
tggattttgtgctggacacaaacacgacttcttttcccaacttggtggggcgttggttcc
acttggttagaattaaatgatcttggaaaaaataagcttaaggctctttaccaagaaaat
gctttttttgcttcctttgtcaaacaattaggagttaccctttccaaggtttatctccct
atctgggaacaatacctgtatcaattgactggttctaatcaatatcttgagccttttcaa
tcagagttggagtcaacaatcttatttttctaccaaataacaggtgaaaaggatttttgt
tttcatcagccctggcttggagaaagtattcaattaagatcaaccatggttcatcctttg
aatctcattcagattgaggccataaaaagaaaagatttaccccttttaagaaaaaccgtc
accggcatttcttgtggtatgttgacaacaggataa

DBGET integrated database retrieval system