KEGG   Legionella sainthelensi: CAB17_02570Help
Entry
CAB17_02570       CDS       T05293                                 

Definition
(GenBank) peptidase S13
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
lsh  Legionella sainthelensi
Pathway
lsh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lsh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAB17_02570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lsh01002]
    CAB17_02570
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lsh01011]
    CAB17_02570
Enzymes [BR:lsh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CAB17_02570
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CAB17_02570
Peptidases and inhibitors [BR:lsh01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   CAB17_02570
Peptidoglycan biosynthesis and degradation proteins [BR:lsh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CAB17_02570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AUH71066
UniProt: A0A2H5FHN4
LinkDB All DBs
Position
3382800..3384449
Genome map
AA seq 549 aa AA seqDB search
MLKNNSTTILLSLLLMILSMPVLSKTTMSQSTDTASTSSTVIPGDIETIITKPMYKNATW
GLRVLNLETGKEVLNLNSDTHFFIGSVRKIFSVGELLNKVGPGHHSLTTVHKEGVIDDGN
LKGNLVLVASGDLTMGGRTLPNGKIAFTPFDHNEADSLGNAILTKTNPLAGYQDLAKQIK
KSGINSINGDVIIDDRLFDAFYFRNQFYVSPIFVNDDVVDVIINPGKVKEKSLVDWRPKS
DAFSVVNELVTVQPNKKYTLELKPILPECIGKPNCFGLIKGDLPSNFSPPLTNSYPLIQT
YRITKPANFARTVFIEALQQAGVDVSKITKVKDNPAHLLKPSHFYNDENQAASLQSLAYQ
EHAKFILKVSYNIGADTSLMLLGLTDGERTMAGSLAMEKKQLHDKYGITTSDYHFVDGSG
GGDTTATSRVVTQWLEIMSQQKTSFDAFFNALPILAVDGSLDFVKNFKANPTLAGAAGNV
YAKPGSYVVGTESGMLLKGQALAGYIHSKNNHNLVFHLVVNNIPINSLDNLLEVFQDQGE
IAAILWRDQ
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagaacaactcgactaccatactgctttctctactgttaatgatcttatctatg
cccgttttaagtaagacaacaatgtctcaaagcactgatactgcatcgacatcatcaaca
gttatccctggggatatagagacaatcatcaccaagcctatgtataaaaatgcgacgtgg
gggttacgtgttctgaatcttgaaacagggaaggaagtgttaaatttaaattcagacact
catttttttataggttcagtccgtaaaatatttagtgtaggtgaattattaaataaggta
ggtccaggacatcactctctaactacagtgcataaagagggtgtgattgacgatggaaac
ctgaagggtaatctggtgctggttgcatcgggtgatttgacgatgggcggtcgtaccctt
cccaatggtaaaatcgcgtttactccatttgatcataatgaagctgattctttaggtaat
gcaattcttacgaaaacaaatcctttggcaggatatcaagatttagcaaaacaaatcaaa
aaatcgggtattaattcaataaacggtgatgttattattgatgacagactttttgatgcg
ttctactttagaaatcaattttatgtctctcctatatttgttaatgatgatgttgtcgac
gtcattattaaccctggtaaagtcaaagaaaaatcgcttgtggactggcgtcccaaatca
gacgcttttagtgtagtcaatgagctcgttaccgtacagcccaataaaaaatataccctg
gaactcaaacctatcctgcctgagtgtatcggaaaacccaattgttttggcttaatcaaa
ggagatttaccaagcaacttttctcctccgttgaccaacagctaccccctgattcaaact
tatagaatcacaaaacctgcgaatttcgcaagaacagtattcattgaggcgctgcaacaa
gcaggggttgatgtgtccaagattaccaaagtaaaagataatcctgcacatctactcaaa
cctagccatttttataatgatgagaatcaggctgcatcgcttcaatcactagcataccaa
gagcatgcaaaatttattctcaaagtgagttacaatataggtgccgatacgagcctaatg
cttttgggcctcaccgatggggagcgtactatggccggtagtttagctatggagaaaaaa
caactccacgacaaatacggtattaccacttcagattatcattttgttgatggcagcggc
ggaggtgataccacggcaacaagtagagtcgttactcaatggttagaaataatgtcacaa
caaaaaacgtctttcgatgccttttttaatgcattacccatccttgcagtcgatggctca
ttagattttgttaagaatttcaaagcaaatccaacactcgctggagcagcaggcaatgtt
tatgcaaaaccaggttcttatgtagtgggcacagaatctggaatgctccttaaggggcaa
gctttagcagggtatatccatagtaaaaataatcataatttggtatttcacctagttgtt
aataatatcccgattaactcattggataatttgctggaggtatttcaggatcaaggcgag
atagcagcaattttatggcgtgatcaataa

DBGET integrated database retrieval system