KEGG   Legionella sainthelensi: CAB17_04595Help
Entry
CAB17_04595       CDS       T05293                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lsh  Legionella sainthelensi
Brite
Enzymes [BR:lsh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CAB17_04595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AUH71421
UniProt: A0A2H5FIR0
LinkDB All DBs
Position
complement(3864267..3864845)
Genome map
AA seq 192 aa AA seqDB search
MTFTLPELPYAKNALEPHISSETLEYHYGKHHQAYVTNLNKLIPGTEFESMKLEEIIKES
KGGIFNNAAQVWNHTFYWHCLSPNGGGEPQGKVAEAINKYFGSFDSFKEKFTQTAITTFG
SGWAWLVQDKAGELKIISTSNAGTPMTEGLTALLTCDVWEHAYYIDYRNARPDYVTAFWN
LVNWDFVADNMK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgacctttacactacctgaattaccctacgcaaaaaatgcgttagaaccccatatttcg
agtgaaacgcttgaataccattatggcaaacatcatcaagcttacgtgactaacttaaat
aaactaattcctggcactgaatttgaatccatgaaattagaagaaattattaaagaatca
aaaggaggaatatttaataatgcagcacaagtatggaatcatactttttattggcattgc
ctaagcccaaatggtggtggagaacctcaaggaaaagttgctgaagcaattaataaatat
tttggctcttttgattcatttaaagaaaaatttacccaaaccgcaatcacaacttttggc
tcgggttgggcatggcttgttcaagacaaagctggtgaattaaaaataatcagtactagt
aatgctggtacaccgatgaccgaaggattaaccgcactgttgacctgcgatgtgtgggaa
catgcttattatattgattaccgtaatgctcgaccagattatgtgactgcattttggaat
ttggtaaattgggattttgtagctgataatatgaagtag

DBGET integrated database retrieval system