KEGG   Legionella sainthelensi: CAB17_07595Help
Entry
CAB17_07595       CDS       T05293                                 

Definition
(GenBank) hypothetical protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
lsh  Legionella sainthelensi
Pathway
lsh00020  Citrate cycle (TCA cycle)
lsh00190  Oxidative phosphorylation
lsh00650  Butanoate metabolism
lsh01100  Metabolic pathways
lsh01110  Biosynthesis of secondary metabolites
lsh01120  Microbial metabolism in diverse environments
lsh01130  Biosynthesis of antibiotics
lsh01200  Carbon metabolism
Module
lsh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lsh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lsh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAB17_07595
   00650 Butanoate metabolism
    CAB17_07595
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CAB17_07595
Enzymes [BR:lsh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CAB17_07595
    1.3.5.4  fumarate reductase (quinol)
     CAB17_07595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3
Motif
Other DBs
NCBI-ProteinID: AUH71943
UniProt: A0A2H5FK78
LinkDB All DBs
Position
197380..197784
Genome map
AA seq 134 aa AA seqDB search
MHFSINRYNPETDTKLYVKDHDLDMPIDFSMMVLDVLQRIRELEGALALCASGCKEVYGS
DEMSFNGLNCFVYITLILSLTLPRVRKPLISFTTIADLVRDFAVFFKQCRRIKSYLQNDF
EPLFKERLQTPQRE
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcatttctctattaatcgttataatcctgagactgatacaaaactctatgtaaaagac
cacgatttggacatgccaatcgatttcagcatgatggtcttggatgttttgcaacgaata
agagaactggagggtgctttagctttatgtgcatcaggttgtaaagaagtttatggttct
gatgagatgagttttaatggattaaattgttttgtgtacatcactttaattttatctcta
acgctacctagggttagaaaaccattaataagtttcactactattgctgatttagtaagg
gattttgcggtatttttcaaacaatgcagacggattaaatcctatttacaaaatgacttt
gaacctctatttaaagagcgacttcaaacaccgcaaagggaatga

DBGET integrated database retrieval system