KEGG   Legionella sainthelensi: CAB17_11125Help
Entry
CAB17_11125       CDS       T05293                                 

Definition
(GenBank) peptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lsh  Legionella sainthelensi
Brite
KEGG Orthology (KO) [BR:lsh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lsh01002]
    CAB17_11125
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lsh04147]
    CAB17_11125
   04090 CD Molecules [BR:lsh04090]
    CAB17_11125
Enzymes [BR:lsh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CAB17_11125
Peptidases [BR:lsh01002]
 Metallo Peptidases
  Family M2
   CAB17_11125
Exosome [BR:lsh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAB17_11125
CD molecules [BR:lsh04090]
 Proteins
  CAB17_11125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AUH72552
UniProt: A0A2H5FLY6
LinkDB All DBs
Position
2580777..2582594
Genome map
AA seq 605 aa AA seqDB search
MKHYYTIILISFYLLLSCHNSGSSSNADAAEVQKFIDNYTKQYVKLYASAKNARWQSNIE
IKANDFTNAKIAQKADKALAVFIGSKENINGARKYLNPKYKLTNMQVKQLELILYAAANS
PQEVADLVEKRIQAEVEQIYKLYGYQYILDGKKIGVNNIDCILRKESNLNKRLSAWEASK
QVGPTLKAGLINLRNLRNQTVQALGYPDFFTYQVSNYHMSTDEMMQTLERFMRDLYPLYR
ELHTWMRYELAKRYGVSTVPKYLPAHWLPNRWGQDWSSVLKEKSINIDAILKNKSPDWIM
KSAESLYVSLGYPKLPATFWKKSNLYPYPSNSSIKKNNHASAWHIDLDQDIRIIMSLESN
AKSFRTAHHELGHIYYYLAYTNKDVPPLLRKGANRAFHEAIGTMMGLAARKKPYLVERGL
IDNSVEIDNMYTLLKEALNSVVFIFFSAGTMSHFEKAMYVDNLSPDQFNVKWWELAKKYQ
GIEPPFIRGEEYCDGATKTHINNDPAQYYDYALSYVLLYQLHNHIAKHILHQDPYATNYF
GQKAVGDFLLNIMRHGASNDWREVLNESTGDELNAKAMLEYFQPLVEWLHEQNKGRNYSL
PEIMV
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattattatacaataatactgatttcattctatctgcttttatcttgtcataat
agtggtagtagctccaatgccgacgcggcagaggtccagaaatttattgataattacacc
aaacagtatgtaaagctttatgcgagtgctaaaaatgcacgatggcaatcaaatattgag
ataaaggctaatgattttacgaatgcgaagattgcgcagaaagcggataaagcactcgct
gtatttattggcagtaaagagaacattaatggtgcccgcaaatacctcaacccaaaatat
aagctcacaaatatgcaagtaaagcaattggagctcattctctatgctgctgctaatagc
cctcaagaggtagctgaccttgtggaaaaaagaatacaagctgaggttgagcaaatatat
aagctatatggatatcagtatatactggatggcaagaagataggcgtgaataacatagat
tgtattcttagaaaagagtctaacctcaataagcgtctgtcagcatgggaagcaagtaaa
caagttggacctactctcaaggcaggacttatcaatttacgcaacttaagaaatcaaaca
gtacaggcattaggataccctgattttttcacatatcaggtaagcaactaccatatgagt
actgatgaaatgatgcagactcttgagcgtttcatgagggatctctaccccctataccgc
gaactgcatacctggatgcgttatgaactcgctaaaagatatggtgtaagcactgtacct
aaatatctgcccgcacactggctaccaaatcgctgggggcaggactggagctctgtattg
aaggaaaagagcatcaatattgatgctatccttaaaaacaaatcacctgattggattatg
aagtcagcagagagtctatatgtaagtcttggttatcccaaactaccggcaacattttgg
aaaaagtcaaatctttacccctatccttccaattcatccattaaaaagaataaccacgca
tctgcatggcacattgatcttgatcaagacatacgtatcataatgagtttagaatctaat
gctaagtcgttcaggaccgctcaccatgagttaggtcatatctattactacctcgcttat
actaacaaagatgttccaccactgctacggaaaggcgcgaaccgcgcctttcacgaagct
attggtaccatgatggggcttgctgccaggaagaagccttatttggtggagcgtggtttg
atcgataactcagtagaaatagataatatgtatactcttcttaaagaagcgctcaactct
gtagtgtttatttttttctctgcgggcacgatgagccattttgaaaaagccatgtatgtt
gataatttatctccagaccagttcaacgtaaagtggtgggagttggctaagaaatatcaa
ggaattgagccgccatttattcgaggtgaagaatattgcgatggtgccactaaaacacat
atcaacaatgatcctgcccaatattatgattatgcattgtcttatgtcctcctatatcag
ctacacaatcatatagccaaacatatactgcaccaagacccttatgcgaccaactacttc
ggtcagaaagctgtaggagactttctactaaatatcatgcgtcatggagcgtctaacgac
tggagggaagtactcaacgagtcaactggtgatgagctgaatgccaaagcaatgttagaa
tactttcaaccactggttgagtggctccatgaacagaataaaggaagaaattatagtctt
ccggaaattatggtataa

DBGET integrated database retrieval system