KEGG   Legionella sainthelensi: CAB17_18730
Entry
CAB17_18730       CDS       T05293                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
lsh  Legionella sainthelensi
Pathway
lsh03030  DNA replication
lsh03430  Mismatch repair
lsh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lsh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CAB17_18730
   03430 Mismatch repair
    CAB17_18730
   03440 Homologous recombination
    CAB17_18730
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lsh03032]
    CAB17_18730
   03400 DNA repair and recombination proteins [BR:lsh03400]
    CAB17_18730
Enzymes [BR:lsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CAB17_18730
DNA replication proteins [BR:lsh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CAB17_18730
DNA repair and recombination proteins [BR:lsh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CAB17_18730
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: AUH73845
UniProt: A0A2H5FQK9
LinkDB
Position
2755975..2756409
AA seq 144 aa
MLQIRVDFYLLANEQHHARWLLACRLLEKAYAKGHKVYVLCTDKEDAELLDELLWTFKED
SFIPHHLQGEGPEPPPPIQIGYEREPRGFNDILLNLSNNIPPFYTKFKRIMEIVLNSETE
KEQSRAHYRSYKANGCALYTHLMK
NT seq 435 nt   +upstreamnt  +downstreamnt
atgctgcaaattcgcgttgatttttacctgttagccaatgagcaacatcacgctcgttgg
ttactcgcatgccgcctcttggaaaaagcttatgctaaaggacataaggtttatgtcttg
tgcactgataaagaagatgctgagttgcttgatgaactcttatggactttcaaagaagac
agctttattccccatcacctgcaaggcgagggacccgagcctcctccccccattcaaatt
ggatatgagcgggaacccagaggatttaatgatattttgttaaacctttccaataatatt
cctcctttttacactaagttcaagcgaatcatggaaatagtccttaatagtgagacagag
aaagaacaaagtcgcgcccattatagaagctataaagcgaatgggtgtgcattgtataca
catctaatgaaatag

DBGET integrated database retrieval system