KEGG   Lactobacillus salivarius CECT 5713: HN6_00894Help
Entry
HN6_00894         CDS       T01962                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase (D-alanylalanine synthetase) (D-Ala-D-Ala ligase)
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
lsi00473  D-Alanine metabolism
lsi00550  Peptidoglycan biosynthesis
lsi01100  Metabolic pathways
lsi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lsi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HN6_00894 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HN6_00894 (ddlA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    HN6_00894 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lsi01011]
    HN6_00894 (ddlA)
Enzymes [BR:lsi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HN6_00894 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:lsi01011]
 Precursor biosynthesis
  Amino acid ligase
   HN6_00894 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: ADJ79170
LinkDB All DBs
Position
complement(1107077..1108213)
Genome map
AA seq 378 aa AA seqDB search
MENKKLHIALLFGGNSSEHDVSKRSAHNIYDALDKDKYDVSVFMFTKKGFLLGNKDSMRI
FDGENEDDVVAEVIKDVDFSNPLANIQNLAEVKDVDVFYPVIHGNMGEDGTVQGLFRLLN
KPWIGSGVASSGVSFDKDLTKKLLTLNGIRNTKYVLVTPENKADYPYAKVAEELGETLFV
KPARQGSSVGIHKVRNEEEYNAALEDGFKYDYKILVEEAIKNPREVECSVLGNRDIKASK
LGAIRIPESDDFYDYNNKFVDASGVVFEMPIKLPEKLTKEIQQMSLDAFRALDNRGLARM
DFLVDENDVPYFGEVNTLPGFTNISLYPQLWEVSGISYSELIDQLIQLAIDEFNDNAKIH
YDFTELGTEKVGKKIIGE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaaaaattacacattgcattgttatttggaggaaactcatctgaacatgac
gtttcaaaacgttctgcacacaatatttatgacgctcttgataaagataagtatgatgta
tctgtctttatgtttactaaaaaaggtttcttgcttggtaataaagactctatgcgtatc
tttgacggagaaaatgaagatgatgttgttgcagaagttatcaaagatgttgatttctcc
aacccattggcaaatatccaaaatttagccgaagttaaagatgttgatgtattttaccct
gttatccacggtaacatgggtgaagacggtacagttcaaggattattccgtttattaaat
aagccttggattggtagtggtgttgcttcttctggtgtttcattcgacaaggatttaact
aagaaattacttactttgaatggaatcagaaatacaaagtatgttttagtaactccagaa
aataaagctgactatccatacgctaaagtagctgaagaattaggtgaaacattatttgta
aaacctgctcgtcaaggttcttctgttggtattcataaagtaagaaatgaagaagaatat
aatgctgctttagaagatggtttcaagtatgattacaagattttagttgaagaagcaatc
aagaatccacgtgaagttgaatgttcagtactaggtaatcgtgatatcaaagcatccaag
ttaggtgcaatccgtattcctgaatcagatgatttttatgactacaacaataaattcgtt
gatgcatctggtgtggtatttgaaatgcctatcaagttaccagaaaaattaactaaagaa
atccaacaaatgtccttagatgcatttagagcattggataaccgtggtttagctcgtatg
gacttcttagttgatgaaaatgatgttccatactttggtgaagtaaatactttaccaggc
tttacaaacatttccttatatccacaattatgggaagtttcaggtattagttatagcgaa
ttaattgatcaattgattcaattagctattgatgaatttaacgataacgctaagattcac
tatgactttacagaattaggaacagaaaaagtgggtaagaagattattggcgaataa

DBGET integrated database retrieval system