KEGG   Lactobacillus salivarius CECT 5713: HN6_00976
Entry
HN6_00976         CDS       T01962                                 

Gene name
uvrA
Definition
(GenBank) Excinuclease ABC subunit A
Organism
lsi  Lactobacillus salivarius CECT 5713
SSDB
Motif
Pfam: UvrA_inter ABC_tran AAA_16 AAA_23 AAA_29 AAA_25 RsgA_GTPase APS_kinase AAA_33 SMC_N DUF2075
Other DBs
NCBI-ProteinID: ADJ79250
LinkDB
Position
complement(1211009..1211614)
AA seq 201 aa
MAQNKIKIRGARAHNLKNIDVDIPKDKLVVVTGLSGSGKSSLAFDTLYAEGQRRYVESLS
AYARQFLGQMDKTDVDSIDGLSPAISIDQKTTSKNPRSTVGTVTEINDFLRLLWARVGTP
ICPNDGHEITSQSPEQMVDKILELPERTKLQILAPIVRGKKGQHKKIIEKVKKDGFVRII
VDGEIHDVEEEIELDKIKSMI
NT seq 606 nt   +upstreamnt  +downstreamnt
ttggctcaaaataaaataaaaattcgcggagcaagggcacataatttaaaaaatatagat
gtcgatatacctaaagataagttggtagtagttactggtttatctggctcaggtaaaagt
tcattagcatttgatactttatatgctgaaggacaacgaagatatgtagagagtctctca
gcatatgcacgtcaattcttgggacaaatggataaaacagatgttgattcgattgatgga
ttatctccagcaatttcaattgatcaaaagacaacttccaaaaacccaagatcgacagta
ggaacagttactgaaatcaatgattttttacgattattatgggcaagagtcggaacacct
atttgtcctaatgatggtcatgaaataacaagtcaatctccagaacaaatggtagataag
atattagaattgccagaaagaactaaattacaaattctagctccaattgtacgaggaaaa
aaagggcaacataagaaaattattgaaaaagtaaaaaaagatggatttgtacgtattatt
gttgatggtgagattcatgatgttgaagaagaaatagagttagataaaataaaaagcatg
atataa

DBGET integrated database retrieval system