KEGG   Lactobacillus salivarius CECT 5713: HN6_01138Help
Entry
HN6_01138         CDS       T01962                                 

Definition
(GenBank) Heat shock protein Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
lsi  Lactobacillus salivarius CECT 5713
Brite
KEGG Orthology (KO) [BR:lsi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lsi03110]
    HN6_01138
Chaperones and folding catalysts [BR:lsi03110]
 Heat shock proteins
  HSP33
   HN6_01138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 DMA
Motif
Other DBs
NCBI-ProteinID: ADJ79391
LinkDB All DBs
Position
complement(1415596..1416486)
Genome map
AA seq 296 aa AA seqDB search
MSDYLVKSLVYDGAIRAYAVDATETVGEAQKLHDTWSAASAAFGRSLIGTLLLSASELSG
DEKMTVKINGDGPIGAIVVDGNAKGTVKGYVHEPHVHLPLNEKHKIDVKGAVGSQGFLSV
TKDLGLKEPFTGQVPLVSGELGEDFTYYLAKSEQIPSAVGLSVFVEDDNTIGVAGGFMIQ
VLPGASDEILDEIEKKLQEIPLVSEMMRKDGKTPEEILYTLFPKDKVKILEKIPVAYECN
CSKERFAEALASLPKKDLEEMIEQDKGAEAVCHFCGKKYEFNEKELTKIMNEANQA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattatttagttaaaagtttagtatacgatggagcaattagagcttatgcagtt
gatgctactgaaactgtaggagaagcacaaaaattacacgatacttggagtgctgcttca
gctgcttttggtagaagtttgataggtactttattattatcagcatcggaactatctggt
gatgaaaaaatgaccgtaaaaatcaatggcgatggaccaattggggctattgtggtagat
ggtaatgctaaaggtacagtcaaaggatacgtacatgaaccacatgtgcatttgccttta
aatgaaaaacataagattgatgttaaaggcgcagtaggtagtcaaggctttttatcagta
actaaagatttaggattaaaagagccttttacaggacaagtgccccttgtatctggtgag
ttaggtgaagatttcacttactatctagctaagtcagagcaaattccatcagccgtagga
ttatctgtttttgttgaagatgataacacaataggtgtagctggtggttttatgattcaa
gttttaccaggagctagtgatgaaattttagatgaaattgaaaagaagttacaagaaata
ccgttagtatctgaaatgatgcgtaaagatggtaagactcctgaagaaattttgtataca
cttttcccaaaagacaaagtaaaaattcttgagaaaataccagtagcatatgaatgcaat
tgttcaaaagaaagatttgctgaagcactagcaagtttacctaaaaaagatcttgaagaa
atgatagaacaagataaaggtgcagaagcagtttgccatttttgtgggaaaaaatacgaa
tttaatgaaaaagaattaactaaaatcatgaatgaagctaatcaagcttaa

DBGET integrated database retrieval system