KEGG   Lactobacillus salivarius JCM1046: LSJ_0664Help
Entry
LSJ_0664          CDS       T03340                                 

Gene name
prkC
Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lsj  Lactobacillus salivarius JCM1046
Brite
KEGG Orthology (KO) [BR:lsj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lsj01001]
    LSJ_0664 (prkC)
Enzymes [BR:lsj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LSJ_0664 (prkC)
Protein kinases [BR:lsj01001]
 Serine/threonine kinases: Other
  Bacterial family
   LSJ_0664 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo Kinase-like RIO1 Haspin_kinase YukC Seadorna_VP7 FTA2 UL45 PIP49_C Cytokin_check_N
Motif
Other DBs
NCBI-ProteinID: AIR10358
UniProt: A0A089QF17
LinkDB All DBs
Position
660980..662683
Genome map
AA seq 567 aa AA seqDB search
MGPGYVLNGRYKIRRVLGEGGMANVYLADDLILNRPVTVKVLRLDLQNDPASLRRFHREA
MALTELTNPNIVNIYDIDQTDDGMQYLVMEYVDGMDLKAYIKKNHKLPYERVIEIMEQIL
SAVEDAHAHNIIHRDLKPKNILIDKNGTVKITDFGIAVAVAEFTMTQTNTLVGSVHYISP
EQARGSMVTKQSDIYSLGIILFEMLTGEVPYQGETAISVALKHYRNDMPSVRNYDNNIPQ
SLENVILHATAKNLNDRYKTVAEMADDLRTVLDEDRKNEKVWRPQNFVDEETKILPQIKD
SFIDENLDETKTLILSEDAIKKNEETTKTREKKQKWSRKKRGITVGAIILALIVVSVVIF
ALITTPKVITMPDLRGMTQTQAESILDNKKLEKGKVTEKYSNLYNYGQIVSTNPKQGSNV
RQKTSVGLVISKGPDKKPFGDYRGQNYDDVKERLENQGVHVYKKLKYTDDVAKDSITSQS
LKPSAAVVMSQTTVTFTVSKGPVHFRLKMFSGMNKSQIESYAKQQNIDVVFQYEASDKFK
SGEVVRQGPAPNAIVERGSQVIVVLAK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgggaccaggatacgttttgaatggacgttataagattcgacgtgttctaggtgaaggt
ggaatggctaatgtttatttagctgatgatttaattttaaatcgaccagttacggtgaaa
gttttaagactagatttacaaaatgatcctgcttctttgagaagatttcatagagaagcg
atggcattaacagaattaactaatcctaatatagttaacatttatgacattgatcaaaca
gatgatggtatgcagtatctagttatggaatatgtagatggtatggatttaaaagcatac
ataaagaaaaatcataaacttccatacgaacgtgtaatagaaattatggaacaaatctta
tcggctgtagaggatgcgcatgcacacaatataattcatagagatttaaagccgaaaaat
attttaattgataagaatgggacagttaagattactgattttggaattgctgttgcagtt
gcggaatttacaatgactcagactaatacattagttggttcagtacattatatttcacct
gaacaagcaaggggaagtatggtaactaagcaatccgatatttattctttaggaataatt
ttgtttgaaatgttaactggtgaagttccgtaccaaggagagacagctatctctgtagct
ttaaagcattatcgtaatgatatgccatctgttcgtaattatgataataatattccacaa
tccctagagaatgtcatattgcatgcgactgctaaaaatttaaatgaccgatataaaaca
gtggcagaaatggcggatgatttaagaacagttttagatgaagatagaaaaaacgaaaaa
gtatggagaccgcaaaattttgttgatgaagaaacaaagatattacctcaaataaaagac
agttttattgacgaaaatttagatgaaactaaaactttaattctctcagaagatgctata
aagaagaacgaagaaactactaagactagagagaaaaaacaaaagtggagcagaaaaaaa
agaggtattacagttggggcaataatattagctttaatcgttgtttcggttgtgattttt
gctttaattacaactcccaaagtaattactatgccagatttaagaggaatgactcaaacg
caggctgaaagcattcttgataacaagaaattagaaaaaggtaaagttacggaaaaatat
tcaaatttatataattatggccaaatagttagtactaatcctaagcagggatcaaatgta
cggcaaaaaacatcggtaggtttggtaatatctaagggaccagataagaaaccatttggc
gattatcgcggacaaaattatgatgatgttaaagagagacttgaaaatcaaggtgtacat
gtctataagaaattgaagtatactgatgacgttgctaaagattcaataacatctcaaagt
ttaaagccaagtgctgctgttgttatgagtcaaacaaccgttacatttacagttagtaag
ggtcccgttcattttaggttaaaaatgtttagtgggatgaataaatctcaaattgaaagt
tacgctaagcaacagaatatagatgtagtttttcagtacgaggcatctgataagtttaaa
agtggtgaagttgtgagacaaggtccggcacccaatgccattgttgagagaggatcacaa
gtaattgttgtgttagctaaataa

DBGET integrated database retrieval system