KEGG   Lactobacillus salivarius JCM1046: LSJ_2204cHelp
Entry
LSJ_2204c         CDS       T03340                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lsj  Lactobacillus salivarius JCM1046
Pathway
lsj00040  Pentose and glucuronate interconversions
lsj00051  Fructose and mannose metabolism
lsj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LSJ_2204c
   00051 Fructose and mannose metabolism
    LSJ_2204c
Enzymes [BR:lsj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     LSJ_2204c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C TrkA_N 2-Hacid_dh_C UDPG_MGDP_dh_N PglD_N Sacchrp_dh_NADP ApbA
Motif
Other DBs
NCBI-ProteinID: AIR11611
UniProt: A0A089QKX4
LinkDB All DBs
Position
pMP1046A:complement(208562..209611)
Genome map
AA seq 349 aa AA seqDB search
MKVAELVDLNKFNLVEKDLPTPSNNEVRVKVMAAGTCGSDSHKMKAGWKYGFPAVMGHEF
SGIIDAVGGDVENIEVGERVAVAPFIPCFECEYCQSGMFQMCENYAMVGQTQPGGFEQYV
CVPARNVLSIGNLSFTEGALIEPMAVAMHAVMGINPEIGDTAAVFGLGAIGDLVIRLLKA
AGVVNIIGIDIDDKKLEKGLEEGCSYVINSVKESLEEKVAEYTNGQGVDITMECAGSKIT
EEQSLLITKRRGKVGFVGIAYSDVMLHKDAFENIFRHELTVKGFWNSYSAPFPGKEWTTS
IKMVKNGSVKIKDLVTHKFELDEIQDAFNMIVSRSESYNKVMFYPNGIE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtagctgaattagttgatttaaataaatttaatttagtagaaaaagacttacca
actccttctaataatgaagttagagtaaaggtaatggcagctggcacttgtggatctgat
agtcataagatgaaagctggctggaagtatggttttccagctgtaatgggacatgaattt
tcaggaattatagatgctgttggtggtgacgtagagaatattgaagtaggggaaagggtt
gctgtagctccgtttattccttgctttgagtgcgaatattgccaatctggaatgttccaa
atgtgtgaaaattatgcaatggttggacaaacacaaccaggtggatttgaacagtatgtt
tgtgtaccagcaagaaatgtattaagtataggaaatctttcttttacagaaggtgcactt
attgaacctatggctgtggcaatgcatgcagtaatggggataaatccagaaattggtgat
acagcagcagtttttggattaggagcaattggtgacctagtaattagacttttaaaagca
gccggtgtcgttaatattattggaattgacatcgacgataagaagttggaaaaaggttta
gaagaaggatgttcatatgttattaattctgttaaagaatctcttgaagaaaaagtagca
gaatatacaaatggacaaggtgtggacattactatggaatgtgcaggttcgaagattacg
gaagaacaatcactacttataactaagagacgtggaaaagtaggttttgtaggaattgca
tattcagatgtgatgttacacaaagatgcatttgaaaatatatttagacatgaattgaca
gttaaaggtttttggaattcttattctgctccattccctggtaaagaatggacaacttct
attaaaatggtaaaaaatggaagcgttaaaataaaagatttagtaacgcataaatttgaa
ttggatgaaattcaagatgcatttaatatgatagtttctagatcagaatcatataacaaa
gtaatgttttatccaaatggaatagaatag

DBGET integrated database retrieval system