KEGG   Lactobacillus salivarius UCC118: LSL_0589Help
Entry
LSL_0589          CDS       T00337                                 

Gene name
tdk
Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
lsl00240  Pyrimidine metabolism
lsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LSL_0589 (tdk)
Enzymes [BR:lsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LSL_0589 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD ATPase_2 AAA_30 Zot
Motif
Other DBs
NCBI-GeneID: 3976720
NCBI-ProteinID: YP_535481
UniProt: Q1WUD7
LinkDB All DBs
Position
633074..633679
Genome map
AA seq 201 aa AA seqDB search
MAQLFFRYGAMNSGKTIEILKVAHNYEEQGKNVIIMTSGLDNRDGYGYVSSRIGLKRKAI
PVVSETNIKDLVEQSSIEPACILVDEAQFLEKHHVLELTQIVDELNIPVMTFGLKNDFMN
ELFEGSKYLLLYADKIEEMKTICWFCNKKAIMNLRMHDSKPVYSGEQIMIGGNESYYPVC
RKHYFNPPINNLEKDEGEING
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaacttttttttcgctatggagcgatgaatagtggtaagacaattgaaatcctt
aaagttgcacataattatgaagaacaagggaaaaatgttattatcatgacaagtggtttg
gataatcgcgatggttatggttatgtctctagtcgtataggtttgaaaagaaaagctatt
ccagttgttagtgaaactaatattaaagatctagtagaacaatcttctatagaacctgcc
tgtattttagttgatgaggcacaatttttagaaaaacatcatgtattggaattaactcag
attgtagatgaactgaatattcctgtaatgacttttgggttaaaaaatgattttatgaat
gagttgtttgaaggatctaaatatcttttattatatgctgacaaaatagaagaaatgaag
acaatttgttggttttgtaataaaaaggctattatgaatttaagaatgcatgattctaaa
ccggtgtatagtggtgaacagataatgattggtggtaatgaatcttattatccagtatgt
agaaaacattattttaatccacctattaataatttagaaaaagatgaaggagaaataaat
ggataa

DBGET integrated database retrieval system