KEGG   Lactobacillus sanfranciscensis: LSA_04440Help
Entry
LSA_04440         CDS       T01627                                 

Gene name
gpmA1
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
lsn00010  Glycolysis / Gluconeogenesis
lsn00260  Glycine, serine and threonine metabolism
lsn00680  Methane metabolism
lsn01100  Metabolic pathways
lsn01110  Biosynthesis of secondary metabolites
lsn01120  Microbial metabolism in diverse environments
lsn01130  Biosynthesis of antibiotics
lsn01200  Carbon metabolism
lsn01230  Biosynthesis of amino acids
Module
lsn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA_04440 (gpmA1)
  09102 Energy metabolism
   00680 Methane metabolism
    LSA_04440 (gpmA1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSA_04440 (gpmA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lsn04131]
    LSA_04440 (gpmA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lsn04147]
    LSA_04440 (gpmA1)
Enzymes [BR:lsn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LSA_04440 (gpmA1)
Membrane trafficking [BR:lsn04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LSA_04440 (gpmA1)
Exosome [BR:lsn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LSA_04440 (gpmA1)
  Exosomal proteins of melanoma cells
   LSA_04440 (gpmA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 CDC24_OB1
Motif
Other DBs
NCBI-ProteinID: AEN98892
UniProt: G2KV03
LinkDB All DBs
Position
438783..439484
Genome map
AA seq 233 aa AA seqDB search
MDKRVSEVDYMSKLVLMRHGESVANYNHTFTGWSDVSLTDEGRREAHEAGRKLNELQIKF
DDAHTSYLKRAIISENIVLSEINQLWIPQHKTWRLNERHYGALRGQNKQKVRAEVGDEQF
MMWRRSFEAVPPRLEVVPDLRRYHDAGIDEPRAESLKMAYQRLVPYWIDEIAPRLMNNHN
QLVIAHGSSLRALIKYLENIDDLGIDGVEVGNAEPIIYTLDHDLRILKKEILN
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggataaaagagtcagcgaggttgattacatgagtaagttagttttgatgcgacatgga
gaaagtgttgccaattataaccacacttttactggctggagtgatgtttccttaacagat
gagggaagacgagaagctcatgaagctggtcgcaaactaaatgaattgcaaattaagttt
gatgatgcccatacatcatatttaaagcgtgcgattatctcagaaaacattgttttgagc
gaaattaatcagctttggattccacaacataaaacttggcgtttaaatgagcgtcattac
ggagcattgcgtggtcaaaacaaacaaaaagttcgtgctgaagtcggtgatgagcagttt
atgatgtggcgacgcagttttgaagcagttcctccaagattagaagtggtgcctgatttg
cgacgttatcatgatgctggaattgatgaaccacgggctgaaagtttaaaaatggcctat
caacgtttagtaccttattggattgatgaaattgctcctcgtttgatgaataaccataat
caattggttattgctcatggaagttctttacgagctttaattaagtatcttgagaacatc
gatgatttaggaatcgatggggttgaagtaggtaatgcagaaccaatcatttatacttta
gatcacgatttacggattttgaaaaaggaaatcttaaattag

DBGET integrated database retrieval system