KEGG   Lactobacillus sanfranciscensis: LSA_05360Help
Entry
LSA_05360         CDS       T01627                                 

Gene name
ung
Definition
(GenBank) Uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
lsn03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:lsn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LSA_05360 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lsn03400]
    LSA_05360 (ung)
Enzymes [BR:lsn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     LSA_05360 (ung)
DNA repair and recombination proteins [BR:lsn03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     LSA_05360 (ung)
 Prokaryotic type
     LSA_05360 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AEN98975
UniProt: G2KVG0
LinkDB All DBs
Position
526057..526746
Genome map
AA seq 229 aa AA seqDB search
MKRFIDNDWWPVLEPEFEKPYYQKLRKFLVEEYSNHKIYPAMNHIFQAFEWTPFSKTKVV
ILGQDPYHGPHQAIGTSFAVEPGVKIPPSLRNIYKELDSDLGIKPVNHGYLKSWAEQGVL
LLNSVLTVRDGVAFSHRNEGWEKLTDCAIHQLSERPEPVVFILWGNAARKKVNLINTDTN
IVIESAHPSPLSANRGFFGSRPFSKTNAALKAMGERPINWQLPENVEME
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagatttattgataacgactggtggccagtgttagagccagaatttgagaaacca
tattaccaaaaattgcgaaagtttttggtggaagaatattcgaatcataagatttatcca
gcaatgaatcatatctttcaagcgttcgaatggaccccatttagcaagacgaaagtggtt
attttaggacaagatccttatcacggaccacatcaagcaattggaactagttttgcagta
gagcccggtgtgaaaattccaccgtcattacgaaacatttataaagaattagatagtgat
ttaggaattaaaccagttaatcatggttatttgaaaagctgggctgaacaaggggtttta
ttgctaaactcagttttgaccgtgcgagatggagtggctttttcacatcgtaacgaaggt
tgggaaaaattaactgattgtgcaattcatcaattatctgaacgacctgagcctgtcgtt
tttatattatggggtaatgctgctcgtaagaaagttaatctaattaatactgatactaat
attgttatagaatctgctcacccaagtcctttgtctgccaatcggggattctttggctct
cgtccattttcaaagacgaatgctgctttgaaagctatgggagaaagaccaatcaattgg
caactaccggaaaatgttgaaatggaatga

DBGET integrated database retrieval system