KEGG   Candidatus Liberibacter solanacearum: CKC_02470Help
Entry
CKC_02470         CDS       T01373                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
lso00473  D-Alanine metabolism
lso01100  Metabolic pathways
lso01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CKC_02470
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CKC_02470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lso01011]
    CKC_02470
Enzymes [BR:lso01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CKC_02470
Peptidoglycan biosynthesis and degradation proteins [BR:lso01011]
 Precursor biosynthesis
  Racemase
   CKC_02470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADR52243
UniProt: E4UD03
LinkDB All DBs
Position
complement(532155..533201)
Genome map
AA seq 348 aa AA seqDB search
MNVLSGCARTAAVVKDNAYGLGFEKIAQTLYNSGVQDFFVAHVGEGVKLRAYVPKAKIFV
LYGIHPGEEKILFDANLIPVISSSQQLTFYLKLMSNGFSHPYALQVDTGFNRLGLSLQEA
LNFAKNFSNKKSDKLSLIMSHLACSEDPVSLMNSSQLEQFLTLMKSYKGIEASLASSAGI
LLGENYHFQLTRPGISLYGGTPAINKLNPMQTVVTAEARIILIREAAAGEVISYGGQKKL
KRNSLIAVAAIGYADGYPLTLSGIDLEHNQAQFPGGKGFIKGYMVPILGKITMDITMFDI
TDSIGIEAGDYIEVFGPNIKLDDVALASRTTNYDLLVRIGTRYARFYT
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgctttctggttgtgcacgaacagcagcagtagtaaaagataatgcctatgga
ctgggttttgaaaaaatagcacaaaccctctacaattctggagtacaagatttttttgtt
gcccatgtaggggaaggagtaaaacttcgtgcatacgtcccaaaagcaaaaatttttgtc
ttatatggtatacatccaggagaggaaaagattctattcgatgcaaatttaatccctgtt
atctcttcatcccaacaacttactttctatttaaaattaatgagcaatggattctctcat
ccttatgctttacaagttgatacaggattcaatagattgggattaagtttacaagaagca
ttgaattttgcaaaaaatttttctaataaaaaatcagataagttgtctctaataatgagt
catcttgcttgttctgaagatccagtatctcttatgaactcttcacaattagagcaattt
cttactcttatgaaaagttataaggggatagaagcaagtttagcttcttcggcaggaatc
ctgcttggtgaaaactatcacttccaattaactcgtcccggaatatcactatatggaggg
acacctgcaatcaataaattaaatcctatgcaaactgttgtaactgcagaagcccgtatt
attctcatccgagaagcagccgcaggagaagtaattagttatggaggacaaaaaaaatta
aaacgcaatagtctaatagccgttgcagctattggttatgcagatggttatcctcttacc
ctttcaggaatagatttagaacataaccaagctcagtttccaggaggaaagggatttatc
aaaggttatatggtccctatcctaggaaaaataacaatggatataacaatgtttgacatt
accgattctatcggcatagaagcaggagattatatcgaagtttttgggcctaatataaaa
ctagatgatgttgctcttgcatctagaaccaccaattatgatcttcttgtaagaattgga
acacgctatgcaaggttttatacgtaa

DBGET integrated database retrieval system