KEGG   Candidatus Liberibacter solanacearum: CKC_04130Help
Entry
CKC_04130         CDS       T01373                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
lso00473  D-Alanine metabolism
lso00550  Peptidoglycan biosynthesis
lso01100  Metabolic pathways
lso01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CKC_04130
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CKC_04130
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CKC_04130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lso01011]
    CKC_04130
Enzymes [BR:lso01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CKC_04130
Peptidoglycan biosynthesis and degradation proteins [BR:lso01011]
 Precursor biosynthesis
  Amino acid ligase
   CKC_04130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ADR52575
UniProt: E4UB96
LinkDB All DBs
Position
complement(866261..867196)
Genome map
AA seq 311 aa AA seqDB search
MVNKEEIKNKHVVVLMGGISSERDVSLLSGRVCAAALEDWGFKVTSIDVDRSIGLILSHL
KPDIAFNALHGGFGEDGLIQSILEFLEIPYTHSGILASALSMDKMRAKKIVSSSGVSVCP
SVLVNRITMDSQHVMSPPYIIKPLKGGSSLGVIVVTEGESVPLDVLQSSSWIHGDQLLVE
QYINGIELSCGIMGEQALSVTEIVSQKSDFYTYDSKYSSSVSSHVLPANIPWSILQEVRR
ISVVAHQAIGCRGISRSDFIFDPVSKEIFWLEINTQPGMTNVSIFPEMAAYAGYSFRDLL
LWMLEDASCSR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaaagaagaaataaaaaataaacacgtagttgttctgatgggaggcatttct
tcagaaagagacgtcagtcttctttcaggaagagtttgtgctgccgctttggaggattgg
ggctttaaagtaacctcgattgatgttgatcgttcgataggtctcattctgtcacatttg
aaaccagatattgcttttaatgctttgcatggaggttttggagaagatgggttgatccaa
tctatattagagtttttggaaattccttatacgcattctggtatattagcgtctgcttta
tctatggataagatgcgtgctaagaaaattgtcagtagttctggtgtatcggtttgtcct
tcggttcttgttaatcgcatcacgatggattctcagcacgttatgtcgccaccttatatc
attaagcctttgaaaggagggtcttctttaggagttatagtggtaacagaaggtgaatcc
gttcctttggatgtattacaatcttcatcatggattcatggagatcagttgcttgttgaa
caatatattaatggtattgagttgagctgtggaattatgggagagcaagcgctttctgtt
actgaaattgtttcacagaaatcagacttctacacttatgattcaaagtattcatcttcc
gtatcttcacatgttttgccagcaaatattccatggagtatccttcaggaagtgcgaaga
atctctgttgtggcacatcaagctattggttgtcgtggaattagtagatcagattttatc
tttgatcctgtttcaaaagaaattttttggttagaaattaatactcaaccgggtatgaca
aatgtttctatttttccagaaatggctgcgtatgcgggatattcttttcgagatcttcta
ttgtggatgttagaggatgcttcatgttcgcgctga

DBGET integrated database retrieval system