KEGG   Candidatus Liberibacter solanacearum: CKC_05405Help
Entry
CKC_05405         CDS       T01373                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
lso00061  Fatty acid biosynthesis
lso00620  Pyruvate metabolism
lso00640  Propanoate metabolism
lso01100  Metabolic pathways
lso01110  Biosynthesis of secondary metabolites
lso01120  Microbial metabolism in diverse environments
lso01130  Biosynthesis of antibiotics
lso01200  Carbon metabolism
lso01212  Fatty acid metabolism
Module
lso_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CKC_05405
   00640 Propanoate metabolism
    CKC_05405
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CKC_05405
Enzymes [BR:lso01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CKC_05405
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CKC_05405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ADR52827
UniProt: E4UDZ9
LinkDB All DBs
Position
1150971..1152311
Genome map
AA seq 446 aa AA seqDB search
MISKILIANRGEIALRILRACKELGISTVAVHSTADSSAMHVRLADESVCIGPPSSKESY
LNIQQIVAACEVTGADAVHPGYGFLSENAKFAEILEAHNIKFIGPSSEHIKIMGDKITAK
ETAQKLGIPVVPGSGEICVRTAMPIAQKIGFPVLVKASAGGGGRGMRIAHSEKNLIEAIN
QARSESLSAFGSDAVYIEKYLKKPRHIEIQIFGDGKGNAIHFGERDCSVQRRNQKIWEEA
HSLISAQDRAEIGEICVQAMKKIEYRGAGTVEFLYENGQFYFIEMNTRLQVEHPITEAIT
GIDLVHEQIYVASENNLSIQQKDIVFSGHAIECRINAEDPENFIPNPGTITHFHAPGGLG
IRMDSASYQGYTVPPHYDSLIAKLIVHGKNRNECMMRLDRALNEIIIDGIKTTIPLFQKL
IKNEDIIQGNYDIHWLEDNYLKKQQY
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgatttccaagattcttatcgctaatcgtggagagattgctctgcgtattttacgtgcc
tgcaaagagttaggaatatctacggttgcggtacattcgacagcagattccagtgcgatg
catgtacgtttagcagatgaaagcgtatgtataggccccccttcttcaaaggaaagctac
ctcaatattcaacaaatagtagctgcgtgtgaagtaacaggcgcagatgctgtccatcct
ggttatgggttcctctcggaaaatgcaaaatttgctgagatattggaggctcataatatc
aagtttattggaccttcttcagaacatataaaaattatgggcgataaaattactgctaaa
gaaaccgctcaaaaacttggcattcccgtggttcctggatctggagaaatatgcgtccgt
accgccatgcctatcgcccaaaaaataggatttcctgttttggtcaaagcctccgcagga
ggaggagggcgtggcatgaggatagctcattctgaaaaaaatctcatagaagcaattaat
caagcacgttcggaatctctctctgcctttggcagtgatgctgtttacatagaaaaatat
cttaaaaaaccgcgccatattgaaatacaaatttttggcgatggaaaaggaaatgctatc
cattttggtgagcgcgattgctctgtacagcgtcgaaatcaaaaaatatgggaagaggca
cactccctaatcagcgctcaagatcgcgcagaaataggagaaatctgtgtgcaggccatg
aaaaaaattgagtaccgtggcgctggaactgtcgaatttctttatgaaaatggacagttt
tattttattgaaatgaacacacgtttacaagtagaacaccctattactgaagctattaca
ggcatagaccttgttcatgagcagatctatgtggcatcagaaaataatttatctattcaa
caaaaggatatagtgttttccggacatgctattgaatgtcgtattaatgctgaagaccca
gaaaatttcatccctaatccgggaacgattactcatttccatgctcctgggggccttgga
ataagaatggattcagcatcttatcaaggatatacagtcccccctcactatgatagcctt
attgctaaattaattgtacacgggaaaaatagaaatgaatgtatgatgcgcttagatcgt
gcattaaatgaaattatcatagatggaatcaaaacaactataccattatttcaaaaactc
ataaaaaatgaagatatcatacaaggaaattacgatatccattggttagaagataactac
ctaaaaaaacaacagtattaa

DBGET integrated database retrieval system