KEGG   Lysobacter soli: GOY17_04620Help
Entry
GOY17_04620       CDS       T06337                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lsol  Lysobacter soli
Brite
KEGG Orthology (KO) [BR:lsol00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GOY17_04620 (ahpF)
Enzymes [BR:lsol01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GOY17_04620 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored HI0933_like DAO Glutaredoxin K_oxygenase FAD_binding_3 AlaDh_PNT_C Thi4 FMO-like NAD_binding_8 DUF2703
Motif
Other DBs
NCBI-ProteinID: QGW64259
LinkDB All DBs
Position
complement(1007411..1008997)
Genome map
AA seq 528 aa AA seqDB search
MLDADLKTQLKAYLEKVTQPIELVASLDDGDKSRELEGLLQDIATLSDRISYSRRDDDAR
RPSFAINRAGTDVGVRFAGIPMGHEFTSLVLALLQVGGHPSKAAPELLEQVRDLEGEYHF
ETYFSLSCQNCPDTVQALNLMSVINPNIHHVAIDGALFQDEVEQRQIMSVPTVLLNGQPF
DQGRMTIEQIMAKLDTGASTRDAEKIKAKDAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVTYTEGPKLASALEQHVREYDVDIMNLQRASKLVPASEPGG
LIEVQLENGASLKSRSVVLSTGARWRQMNVPGEQEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLIEFDGQLRADEVLQRKLRSLANVTVITNGQTTEVLGDG
QKVTGLIYKDRVSGDPIQVDLEGIFVQIGLLPNTEWLKGAVALSPRGEIEVDSHGRTSVP
GVFAAGDATTTPFKQIVIAMGEGSKAALSAFDHLIRTSAPAQATAAAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccgatctcaagacccagttgaaggcctacctcgaaaaggtcacgcagccg
atcgagctcgtcgcctcgctcgatgacggcgacaagtcgcgcgagctggaaggcctgctg
caggacatcgccacactgtcggacaggatttcctattcgcgccgcgacgacgacgcccgc
cgcccgtccttcgcgatcaaccgcgccggcacggacgtgggcgtgcgcttcgccggcatt
ccgatgggccacgagttcacctcgctcgtgctcgccctgctgcaggtcggcgggcatccg
tccaaggccgcgccggagctgctggagcaggtgcgcgacctggaaggcgaataccacttc
gaaacctacttctcgctctcgtgccagaactgcccggacaccgtgcaggcgctgaacctg
atgagcgtgatcaacccgaacatccaccacgtcgccatcgacggcgcgctgttccaggac
gaagtcgagcagcgccagatcatgtcggtgccgacggtgctgctcaacggccagccgttc
gaccagggccgcatgacgatcgaacagatcatggccaagctcgacaccggcgcatcgacg
cgcgatgccgagaagatcaaggccaaggacgcgttcgacgtgctcgtgatcggcggcggc
ccggcgggcgccgcggcggcgatctacgccgcgcgcaagggcatccgcacgggcgtggcg
gccgagcgcttcggcggccaggtgctcgatacgatggcgatcgagaacttcatctccgtc
acctacaccgagggcccgaagctcgccagcgcgctggaacagcacgtgcgcgagtacgac
gtcgacatcatgaacctgcagcgcgcgagcaagctggttccggcgagcgagccgggcggc
ctgatcgaagtgcagctggagaacggtgcgtcgctgaagtcgcgcagcgtggtgctgtcg
acgggtgcgcgctggcgccagatgaacgtgccgggcgagcaggaataccgcaacaagggc
gtggcgtactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactcgggcgtcgaggccgcgatcgacctggcgggcatcgtttcgcacgtc
acgctgatcgagttcgacgggcagctgcgcgccgacgaagtgctgcagcgcaagctgcgt
tcgctggcgaacgtcacggtcatcaccaacgggcagacgaccgaagtgctcggcgacggc
cagaaggtgacgggtctgatttacaaggaccgcgtttcgggcgacccgatccaggtcgac
ctggaaggcatcttcgtgcagatcggcctgttgccgaacaccgaatggctgaagggcgcc
gtggcgctgtcgccgcgcggcgaaatcgaggtcgattcgcacggccgcacgtcggtgccg
ggcgtgttcgccgccggcgacgccacgaccacgccgttcaagcagatcgtcatcgcgatg
ggtgaaggctcgaaggctgcgctgagcgccttcgaccacctgatccgcaccagcgcaccg
gcgcaggccaccgccgccgcggcgtaa

DBGET integrated database retrieval system