KEGG   Lonchura striata domestica (Bengalese finch): 110468201
Entry
110468201         CDS       T05897                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04010  MAPK signaling pathway
lsr04060  Cytokine-cytokine receptor interaction
lsr04068  FoxO signaling pathway
lsr04144  Endocytosis
lsr04218  Cellular senescence
lsr04350  TGF-beta signaling pathway
lsr04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110468201 (TGFBR2)
   04350 TGF-beta signaling pathway
    110468201 (TGFBR2)
   04068 FoxO signaling pathway
    110468201 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110468201 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110468201 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    110468201 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110468201 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lsr01001]
    110468201 (TGFBR2)
Enzymes [BR:lsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110468201 (TGFBR2)
Protein kinases [BR:lsr01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   110468201 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 110468201
NCBI-ProteinID: XP_021381540
LinkDB
Position
2
AA seq 568 aa
MTPRLPSSLRRLLLRLSLWALMGSSVPALLRAEFTSPVERNKEGGLKMPNLCKFCDIKVT
TCSNQHQCKSNCNITSICEKSSEVCVAIWRQNDENVTLETICHDPEETLYGHFLDDYKSE
QCLMREKKDDGGLMFMCSCTGEECNDMLIFTSDDPHKPEEKDEISKVTIISLVPLLVISV
AVIVIFYAYRTHKKRKLSKTWEKNVKPKKHKDCSDVCAIMLDDDRSDISSTCANNINHNT
ELLPIELDVVVGKGRFAEVYKAKLKQNTSEQYETVAVKIFSYEEYASWKTEKDIFSDVNL
KHENILQFLTAEERKTDLGKQYWLITAFHAKGNLQEYLTRHIISWEDLWKLGGSLARGIA
HLHSDHTPCGRPKTPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPSLSVDDLANSGQV
GTARYMAPEVLESRMNLENMESFKQTDVYSMALVLWEMTSRCNAVGEVKEYEPPFGSKVR
EHPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLIECWDHDPEARLTAQCVAERFS
ELKHHDRLSGRSCSEEKIPEDGSVTTAK
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgactccccggctgccgagcagcctgcggcggctgctgctgcgcctctccctctgggcg
ctgatgggcagctcggtccccgctctgctccgggctgaatttacatcacctgtggaaaga
aataaggaaggtggactgaaaatgccaaacctatgcaaattttgtgatattaaagtaaca
acctgctcaaaccaacatcagtgtaagagcaactgtaacatcacttctatctgtgagaag
agtagtgaagtctgtgttgctatatggagacagaatgatgaaaatgtgacattagaaaca
atatgccacgatcccgaagaaacactgtatggtcactttttggatgactataaatcagag
caatgtttgatgagggaaaagaaggatgatgggggattgatgttcatgtgttcctgcaca
ggtgaagaatgcaatgatatgctcatttttacatcagatgaccctcataaaccagaggag
aaagatgaaatttccaaagtcacaatcataagtcttgtcccattactggtgatttctgtt
gctgtgattgttatcttttatgcctaccgcactcacaagaagaggaaactcagcaagacg
tgggagaagaatgttaagcccaagaagcataaggactgcagtgatgtctgtgccattatg
ttagatgacgaccgctcagacatcagctccacgtgtgccaacaacatcaaccacaacaca
gagctgctgcccattgagttggacgttgttgttggcaaaggaaggtttgctgaagtgtat
aaagccaaattgaagcaaaacacatcagaacagtatgaaactgtggcagtcaagattttc
tcctatgaagaatatgcttcctggaaaactgagaaagacattttttcagatgtaaacctc
aagcatgagaacatactccagttcttgacagcagaggagcgtaagacagatcttggcaaa
caatattggttgatcactgccttccatgctaaaggaaacttgcaggaatatctcacacgg
cacattatcagctgggaggacctctggaaacttggtgggtccttggcccgagggattgcc
catctacacagtgatcacacaccctgtggtcgtcccaaaacaccaattgtacacagagac
ctaaagagttccaacatcctggtgaaaaatgatttaacctgctgtctctgtgactttggg
ttatccctgaggctggacccttccttgtctgtggatgacttagctaacagtgggcaggtg
ggcacagcaagatatatggcccctgaggttttggagtccaggatgaacctggagaacatg
gagtccttcaaacaaacagatgtgtactccatggctttggtcctctgggaaatgacatct
cgctgtaacgctgtcggagaagtgaaagagtacgagcccccatttggctccaaagtgcga
gaacacccttgtgtggaaagcatgaaggacaatgtcctgagagacagagggcgacctgag
atccccagctcctggcttaaccatcagggcatccagatggtgtgtgaaaccctcattgag
tgctgggaccacgaccccgaggcccgactgacggcgcagtgcgtggccgagcgcttcagc
gagctcaagcaccacgaccggctctcagggaggagctgctcggaggagaagattcccgaa
gacggctccgtgaccactgcgaagtag

DBGET integrated database retrieval system