KEGG   Lonchura striata domestica (Bengalese finch): 110468859Help
Entry
110468859         CDS       T05897                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04010  MAPK signaling pathway
lsr04020  Calcium signaling pathway
lsr04114  Oocyte meiosis
lsr04140  Autophagy - animal
lsr04261  Adrenergic signaling in cardiomyocytes
lsr04270  Vascular smooth muscle contraction
lsr04310  Wnt signaling pathway
lsr04340  Hedgehog signaling pathway
lsr04371  Apelin signaling pathway
lsr04530  Tight junction
lsr04540  Gap junction
lsr04910  Insulin signaling pathway
lsr04912  GnRH signaling pathway
lsr04914  Progesterone-mediated oocyte maturation
lsr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110468859 (PRKACB)
   04310 Wnt signaling pathway
    110468859 (PRKACB)
   04340 Hedgehog signaling pathway
    110468859 (PRKACB)
   04371 Apelin signaling pathway
    110468859 (PRKACB)
   04020 Calcium signaling pathway
    110468859 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110468859 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110468859 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110468859 (PRKACB)
   04540 Gap junction
    110468859 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110468859 (PRKACB)
   04912 GnRH signaling pathway
    110468859 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    110468859 (PRKACB)
   04916 Melanogenesis
    110468859 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110468859 (PRKACB)
   04270 Vascular smooth muscle contraction
    110468859 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lsr01001]
    110468859 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lsr03019]
    110468859 (PRKACB)
   03036 Chromosome and associated proteins [BR:lsr03036]
    110468859 (PRKACB)
Enzymes [BR:lsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     110468859 (PRKACB)
Protein kinases [BR:lsr01001]
 Serine/threonine kinases: AGC group
  PKA family
   110468859 (PRKACB)
Messenger RNA biogenesis [BR:lsr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     110468859 (PRKACB)
Chromosome and associated proteins [BR:lsr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110468859 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110468859
NCBI-ProteinID: XP_021382755
LinkDB All DBs
Position
Unknown
AA seq 354 aa AA seqDB search
MGNAATAKKGNEIESETFVKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGR
VMMVKHKSTEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNL
YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQ
QGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKW
FATTDWIAIYQRKVEAPFIPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgcagccaccgccaagaagggcaacgagatcgagagcgagacgtttgtgaaa
gagttcctagccaaagccaaagaagacttcttaagaaaatgggaaagcccccctcagaat
actgctggcctagatgattttgagcggcaaaaaacccttggaacaggatcatttgggaga
gtaatgatggtgaaacataaatccacagaacagtattatgctatgaagatattggacaaa
cagaaggtcgtcaaactgaagcagatagaacacacactgaatgagaagaggatattacaa
gcagtgaactttcctttccttgttaaactggagtattcttttaaggacaattctaattta
tacatggtaatggagtatgttcctggtggagaaatgttttcacatctaagaagaatcgga
aggttcagtgaaccacatgcacggttttatgcagctcagatagtgctaacatttgagtac
ctccattcattagacctcatctacagagatctaaagcctgaaaatcttttaattgatcag
caaggatacatccaggtcacggactttggctttgcaaaaagagtaaaaggcagaacttgg
acgttatgtgggactccagaatacctggcacctgaaataattctcagcaagggttacaac
aaggcagtggattggtgggcgctaggagtgttaatctatgaaatggcagctggatatccc
ccattctttgcagatcagcccattcaaatttacgagaagattgtgtctggcaaggtgagg
ttcccatcacacttcagttcagacctaaaggatcttctaagaaatttactccaggtagat
ttgaccaaacgatatggaaatctcaagaatggtgtaaatgacataaagaatcacaagtgg
tttgcaactacagattggattgccatttatcagagaaaggtagaagctccattcatacca
aagtgcagaggtcctggagataccagcaactttgatgactatgaagaagaagatattcgt
gcttctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system