KEGG   Lonchura striata domestica (Bengalese finch): 110469367
Entry
110469367         CDS       T05897                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04010  MAPK signaling pathway
lsr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110469367 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110469367 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lsr04052]
    110469367 (KITLG)
Cytokines and growth factors [BR:lsr04052]
 Growth factors
  Growth factors (RTK binding)
   110469367 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 110469367
NCBI-ProteinID: XP_021383693
LinkDB
Position
1A
AA seq 285 aa
MKKAQTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYMITLKYVPK
MDSLPSHCWLHLMVPEFSRSLHNLLQKFSDIPDMSDVLSNYSIINNLTRIINDLMACLAF
DKNKDFVKENGHLYEEGHFIPEDFFRHFNSTIEVYKESADRLDKNDCILPSTVGTLENDS
RVAVTKTFLFPPVAASSLRNDSIGSSTSSNKEALGFISSSSLQGISIALASLLSLLIGFI
LGAIYWKKIHPKSRPESDETTQCRDYQEENEISMLQQKEKEHLQV
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcttttgtcttcaactcctcctacttaat
cctcttgtcaaagcccaaagttcctgcgggaatccagtcacagatgatgtgaatgacatt
gcaaaattggttggaaatctcccaaatgattatatgataacccttaaatatgtcccgaag
atggatagtctgcctagtcactgttggttgcatttgatggtgcctgaattttcaaggagt
ctacataatcttctccagaaattttcagatattccagatatgtcagatgttttaagcaac
tattcaatcatcaataatctcacaaggataattaatgatcttatggcatgccttgctttt
gataaaaacaaggattttgtgaaagaaaatggtcacctctatgaagagggtcacttcatt
cctgaggatttttttaggcactttaatagtaccattgaggtctacaaagagtctgcagac
agattggataagaatgactgcatcctgccttcaacagtaggaactctggagaatgattcc
agagtcgctgtcacaaaaacatttttgtttcctcctgttgctgccagctctcttaggaat
gacagcattggcagtagcactagcagtaacaaagaagcacttggcttcatcagcagctcc
agcctgcaagggatcagcatagcactggcatcattgctgtctctccttattggctttatt
ttgggagccatatactggaagaaaatacatcccaaatccagaccagaaagtgatgaaact
acacagtgtcgtgactatcaagaggaaaatgagataagtatgttgcagcaaaaagaaaag
gaacatctacaagtgtag

DBGET integrated database retrieval system