KEGG   Lonchura striata domestica (Bengalese finch): 110469631
Entry
110469631         CDS       T05897                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04068  FoxO signaling pathway
lsr04110  Cell cycle
lsr04115  p53 signaling pathway
lsr04218  Cellular senescence
lsr04310  Wnt signaling pathway
lsr04340  Hedgehog signaling pathway
lsr04371  Apelin signaling pathway
lsr04510  Focal adhesion
lsr04530  Tight junction
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110469631 (CCND1)
   04340 Hedgehog signaling pathway
    110469631 (CCND1)
   04371 Apelin signaling pathway
    110469631 (CCND1)
   04068 FoxO signaling pathway
    110469631 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110469631 (CCND1)
   04115 p53 signaling pathway
    110469631 (CCND1)
   04218 Cellular senescence
    110469631 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110469631 (CCND1)
   04530 Tight junction
    110469631 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 110469631
NCBI-ProteinID: XP_021384218
LinkDB
Position
5
AA seq 292 aa
MEHQLLCCEVETIRRAYLDASLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggatgcc
agcctcctcaatgacagggtgctgcagacaatgctgaaggcggaggagacctgctcgccc
tccgtctcctacttcaagtgcgtgcagaaagaaatcttgccatatatgcggaaaatagtt
gccacttggatgctggaggtttgcgaggagcagaagtgcgaagaggaagttttccccttg
gctatgaattatttggacagatttttgtcgttcgaacccctcaagaaaagccgattgcaa
ttgctcggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctcacc
gcagaaaaactgtgcatttatacagataactccattagacccgacgaattactgcaaatg
gagctgctgctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacattttcttactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccaccc
tccatgatcgcagctggcagcgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgagtccctcctggagtccagtctacgc
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggacgaagcagacctc
tcttgcacacctaccgatgtgcgagacgtgaacatttaa

DBGET integrated database retrieval system