KEGG   Lonchura striata domestica (Bengalese finch): 110469831
Entry
110469831         CDS       T05897                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04010  MAPK signaling pathway
lsr04020  Calcium signaling pathway
lsr04144  Endocytosis
lsr04510  Focal adhesion
lsr04540  Gap junction
lsr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110469831 (PDGFRA)
   04020 Calcium signaling pathway
    110469831 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110469831 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110469831 (PDGFRA)
   04540 Gap junction
    110469831 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110469831 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lsr01001]
    110469831 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lsr04090]
    110469831 (PDGFRA)
Enzymes [BR:lsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110469831 (PDGFRA)
Protein kinases [BR:lsr01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110469831 (PDGFRA)
CD molecules [BR:lsr04090]
 Proteins
  110469831 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Herpes_gE Adeno_E3_CR1 Kinase-like
Other DBs
NCBI-GeneID: 110469831
NCBI-ProteinID: XP_021384694
LinkDB
Position
4
AA seq 1096 aa
MENSRLLAAMGTYPQTFLILGCFLTGPFLTFCQLPLPTIVPNRNEMVVQLYSNFTLKCSG
DSEVSWQYPVTEGNHRIDIRHEENNSGFFVTVLEVGNASAAHTGLYVCYYNHTQVEDGEV
EGKDIYIYVPDPDMPFVPSIPEDQFILVEEGDPAVIPCRISDPDAQVTLVNNLDKPVHAL
YDTKQGFIGNFPAGSYMCKTMVKGVEFKSDEFLIYIIRATSQLPVEIEALKTVYKTGETI
VVTCVVFDNEVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECT
ARHATKEVKENKKVAITVHDKGFVHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLK
DNVTLIENLTEIVTTSGRVQETRFQSILKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLI
QVPALISALVDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCNNDTSWTLLTNNISD
IHMEAHLDEKNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAV
LVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRD
GLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHL
GPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLNRHPEKPKKDLDIFGMN
PADESTRSYVILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKK
SMSESEVKNLLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKI
VKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSL
GGTPYPGMMVDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVE
SLLPGEYKKSYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRL
SADSGYIIPLPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMM
DDIGIDSSDLVEDSFL
NT seq 3291 nt   +upstreamnt  +downstreamnt
atggagaattccaggttgttggcagctatgggtacttacccacagacattcctgatcctg
ggatgtttcctcacaggaccattcctaacattttgccagcttcctctgccaactattgtt
cccaataggaatgaaatggtggtacagctgtattccaatttcacactcaaatgctctgga
gacagcgaagtgagctggcagtacccagtgaccgagggaaaccacaggatagacattaga
cacgaagagaacaacagtggcttctttgtgacagtgctcgaagtaggaaatgcctcggct
gcccatacgggcttgtatgtttgctactataaccacacacaagtggaggatggggaggtg
gaagggaaggacatctacatctatgtgcctgacccagacatgccttttgttccttctata
ccagaagaccagttcatcctagtagaagaaggtgatcctgcagttatcccttgtcggata
agtgacccagatgctcaagtgactttagttaacaatttagacaagcctgtgcatgcttta
tatgacaccaaacaaggcttcatagggaattttcctgcgggctcatacatgtgcaaaaca
atggttaaaggcgtggagttcaagtctgatgagttcctcatctatatcataagagctact
tcacagctgcctgttgaaattgaagctcttaaaactgtctacaaaacaggcgagaccatc
gtagtaacttgtgtggtctttgacaatgaggtggttaatttacagtggaattatcctggg
aaagtgaaagaaaaaggtctgataaaacttgatgatatcaaagtgccatcgcagaagctg
gtttacaccctgaccattcctgaggcatcagtgaaagacacaggcgattatgaatgtacc
gctcggcatgcaaccaaggaggttaaggaaaataagaaagtagccattacagttcatgac
aaaggctttgttcacctggagcctcagttcagccctctggaagctgtcaacctgcatgaa
gtcaaaaactttgttgttgatgtgcaggcttacccagcaccaaaaatgtactggttgaag
gataatgtaactctgattgaaaatcttacagagattgttactacatcaggaagagtccag
gaaacgaggtttcagagtattttaaaattgatacgggccaaggaggaagacagtggatac
tacactttggttgctgaaaatgaagatgagattaaaagatacaccttctcattgctcata
caagttccagctctgatctcagccctcgtggatgatcaccatggctctgcaggtgggcag
acagtgagatgcttggcagaaggaaccccacttcccgatgtggaatggctggtttgcaag
gacattaaaaagtgcaacaatgacacctcttggacccttttgactaacaatatctctgat
atacatatggaagcccacttggatgagaaaaatatggtggaaagccaggtgaccttccag
aaggtagaggaaaccctggctgtgcgatgtgtggcaaggaatgacctcggtgctgttact
cgagaactgaagcttgtggctcccaccttgaggtcagagctaacagtggctgctgctgtc
ttagtgctgttagtgatcgtgataatttccctgattgtcctggttatcatatggaaacag
aagccaaggtatgagatcagatggagagtcattgagtctatcagccctgatggccacgag
tacatttatgtggacccaatgcaactgccttatgactccagatgggagtttcctcgagat
gggttagtgcttggtcggatccttggttcgggagcatttggaaaagtagttgaagggact
gcatatggattgagtcgctctcaaccggtgatgaaagtagctgtgaaaatgctgaaacct
acagctagatccagtgaaaaacaggcactcatgtctgaactgaaaataatgacacatctt
ggcccccacttgaatattgtgaatctgcttggagcttgtacaaaatcaggtcctatttat
atcattactgaatattgtttttatggcgatttggtgaactacctgcataagaatagggac
aatttcctgaaccgacacccagaaaagcctaaaaaagatttggatatctttgggatgaac
cctgctgatgaaagcacaagaagctatgtgatactatcgtttgaaaacactggagaatac
atggacatgaaacaagctgataccactcagtatgtgccaatgctggaaaggaaggagggc
tctaaatattctgatattcagagatctgtgtatgatcggcctgcttcgtataagaagaaa
tccatgtcagaatcagaagtcaaaaaccttctttcagatgatagttcagagggcctcagc
ctactggatttgctgagcttcacctaccaggttgcacggggaatggaattcttggcttct
aagaattgtgtgcaccgtgacttggccgctcggaatgtcctcctggctcaaggaaaaatt
gtgaagatctgtgactttgggctggctagagacatcatgcatgattccaactatgtctcc
aagggcagtactttcctcccagtaaaatggatggcacctgaaagtatttttgacaacctg
tacacaacattaagtgatgtctggtcttatggcattctgctgtgggaaatattttctctt
ggtggcacaccgtatcctggcatgatggtcgattctactttctacaataagatcaagagt
ggatatcgaatggccaaacctgatcatgctaccaatgaagtgtatgagattatggtgaag
tgctggaacagtgaaccagagaaaagaccttctttctatcatttgagtgaaattgtggag
agcttgttgcctggagagtacaaaaagagctatgagaagattcatctggacttcctgaaa
agtgaccacccagctgtcacacgcatgagaggggactgtgacaatgcctacattggtgta
acttacaagaatgaagacaagctaaaggacagggagagtggatttgatgagcagaggctg
agtgctgacagtggatacatcattcccctgcctgacattgaccctgtttcagaagatgaa
cttggcaaaagaaacagacacagttcacagacatctgaagaaagtgccattgaaactggt
tccagtagctctaccttcatcaagagagaggacgagaccattgaggacattgacatgatg
gacgacattgggatcgactcctcagacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system