KEGG   Lonchura striata domestica (Bengalese finch): 110469887Help
Entry
110469887         CDS       T05897                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00010  Glycolysis / Gluconeogenesis
lsr00051  Fructose and mannose metabolism
lsr00052  Galactose metabolism
lsr00500  Starch and sucrose metabolism
lsr00520  Amino sugar and nucleotide sugar metabolism
lsr00524  Neomycin, kanamycin and gentamicin biosynthesis
lsr01100  Metabolic pathways
lsr01200  Carbon metabolism
lsr04910  Insulin signaling pathway
Module
lsr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lsr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110469887
   00051 Fructose and mannose metabolism
    110469887
   00052 Galactose metabolism
    110469887
   00500 Starch and sucrose metabolism
    110469887
   00520 Amino sugar and nucleotide sugar metabolism
    110469887
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110469887
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110469887
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lsr04131]
    110469887
Enzymes [BR:lsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110469887
Membrane trafficking [BR:lsr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110469887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 110469887
NCBI-ProteinID: XP_021384753
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKEDQVKKIDKYLYAMRLSDETLLDVMARFRREMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIMH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGFLITWTKRFKASGV
EGADVVRLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGL
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQYARRLHKTTRRLVPDSEVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKLT
HEQLLQVKKRMRAEMEAGLKKKTHDTAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVDGEQGRMCVNTEWGAFGDNGCLDD
IRTIYDKAVDDFSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRH
IFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAA
IVDKIRENRGLERLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPNCDVTFLLSEDGSGKG
AALITAVGCRLREAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcccagctcctggcctactacttcacggagctgaaggaggaccaggtcaaa
aagattgacaagtacctctacgccatgcggctctcggacgaaacactgctggatgtcatg
gctcgcttcaggagggagatgaagaacggcctctccagggatttcaacccaacggccaca
gtgaagatgcttcccacctttgtgaggtccattcctgacggttcagagaaaggagatttc
attgcactggatcttggtggctcttacttccgaattcttcgggtaaaggtatcgcatgaa
aaaaagcagacggtgcagatggaaagtgaaatttataataccccagaggacatcatgcat
gggagtggaacacggctttttgatcatgttgctgaatgcctgggagactttatggagaaa
caacaaatcaaagacaagaaactaccagtcgggtttacgttttccttcccctgtcgacaa
tccaagctagatgagggttttctgataacctggacaaagcgcttcaaagcgagcggagtg
gagggagcagatgtcgtgaggctgcttaacaaagccatcaagaaacgtggggactacgat
gcagacatcatggctgtggtgaacgacaccgtgggcaccatgatgacctgtggctttgac
gaccagcgctgcgaagtcggcttgatcatcggcacgggcaccaacgcctgctacatggag
gagatgaggcacatcgacctggtggagggggacgagggcaggatgtgcattaacacggag
tggggggccttcggagacgacggctcgctggaagacatcaggacggagttcgaccgagag
atcgaccgtggatcccttaatcctgggaagcagctgtttgagaagatggtcagtgggctg
tacatgggggagctggtaaggctcatcctggtgaagatggccaaggaggggctgctcttt
gaggggagaatcacccctgagcttctcaccaaagggaagtttgagacaaagcatgtttct
gccattgaaaagagcaaagagggtttgaacaaagccaaagaaatcctgacccggctgggg
gtggagccgtcccacgaggactgcatcgctgtccagcacgtctgcaccatcgtgtccttc
cgctccgccaacctggtggcctccaccctgggcgccatcctcaaccagctgcgggacaac
aagggcgtggggcgcctccgcaccaccgtgggcgtggacggctccctctacaagatgcac
ccacagtacgcccggcgcctgcacaagaccacgcggcgcctggtgcccgactcggaggtg
cggttcctgctgtcggagagcggcagcgggaagggagcggccatggtgacggccgtggcc
taccggctgtcggagcagcaccgcctcatcgacgagaccctggccgagttcaagctcacc
cacgagcagctgctgcaggtgaagaagaggatgagggcggagatggaagcggggctgaag
aagaagactcacgacactgccaaagtgaaaatgctgcccaccttcgtccgcagcacgccg
gatgggacagagaatggagactttctggcacttgaccttggagggacaaactttagagtt
ttgctagtgaaaatccgcagcggtaaaaggagaacagttgagatgcacaacaagatctat
gccattcccatagaggtgatgcagggaacaggagaagagctgtttgatcacattgttacc
tgcatttctgacttcctggattatatggggataaaaggagcacgtcttcctcttggcttc
accttttccttcccttgcaagcagacaagtctggatgctggtatccttctcaattggaca
aaaggcttcaaagctacagactgtgagggagaagatgtggtatatttacttagagaagga
attaaaagaagagaggaatttgacttggatgtggtggctgtggtgaatgacacagtgggc
acaatgatgacttgtgcttatgaagatccaaactgtgaaattgggctcattgtgggaacg
ggcagcaatgcctgttacatggaggagatgagaaacatcgagatggtggatggtgagcag
gggaggatgtgtgtgaacacggagtggggagccttcggggacaacgggtgcctggacgac
atcaggacaatatatgacaaagcagtcgatgacttctccctgaatgctggcaagcagagg
tatgagaaaatgatcagcggcatgtacctgggggaaatagtccgcaatattttgatcgac
ttcaccaaacggggtttcctgttccgaggccagatttcagagacactgaagaccagacat
atctttgaaaccaagttcctttctcagattgagagtgacaggttagccttgctgcaggtg
cgaaccatcctccagcagctggggctcaacagcacctgtgacgacagcatcattgtcaag
acagtctgcggggcggtgtcgaggcgagcagcccagctgtgtggcgctggaatggctgcc
attgtagataaaattagggagaacagagggttagagcgcctggagataacggttggtgtg
gatggcactctctacaaactccacccacacttctcgaggatcatgcaccaaacagtgaaa
gatctggcacccaactgcgatgtgaccttcctgctgtcggaggacggcagcgggaaaggg
gcagcgctcatcacagcggtgggatgcaggcttcgtgaggctgagcagaactga

DBGET integrated database retrieval system