KEGG   Lonchura striata domestica (Bengalese finch): 110469948
Entry
110469948         CDS       T05897                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
lsr  Lonchura striata domestica (Bengalese finch)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 Ras_bdg_2 Mst1_SARAH PHD
Other DBs
NCBI-GeneID: 110469948
NCBI-ProteinID: XP_021384880
LinkDB
Position
12
AA seq 342 aa
MELIELRELQPEPRPGRGRLERANALRISPARRPGPGAHPDPRLTAAPGAGHRFEPRRRG
LHTWCDLCGDFVWGGGRKSLQCRHCSFTCHYRCRALVQLDCGGPPGAGDEDDGNEQVLEK
DTNVDEPSEWEKTELDQAQVEQRIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVS
VPSTKRGPSLQAGRPHPQGVKRRTSFYLPKGTVKHLHIFSHTRASEVIDALLRKFTVIDN
PRKFALFERSEKDEQVYLRKLGDEEQPLRLRLLAGPSEKVLSFILKENETGEVNWDAFTL
PELHNFLLILQREEEEHVRRLRHRYARCRQKMQEALAALTPG
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggagctcatcgagctgcgggagctgcagccggagccgcggccgggccggggccgcctg
gaacgggccaacgcgctgcgcatcagcccggcccgccggcccggccccggggcgcaccct
gacccgcggctgacggcggcaccgggcgccgggcaccgcttcgagccgcggcgccgcggg
ctgcacacctggtgcgatctctgcggggacttcgtctggggcggcggcaggaagagcctc
cagtgccgccactgcagcttcacctgccactaccggtgccgggccctggtgcagctggac
tgcggtggccccccaggggctggtgatgaggacgatggcaatgagcaggtgctggagaag
gacaccaacgtggatgagcccagcgagtgggagaagacagagctggaccaggcgcaggtg
gagcagcggatcaaggagtacaacagccaaatcaacagcaacctcttcatgagcctgaac
aaggatggctcctacaccggcttcatcaaggtgcagctgaagctggttcgtcctgtctcg
gtgccatccaccaagcggggcccgtccctgcaggcggggcggccacacccccagggggtg
aagcgccgcacgtccttctacctgcccaaggggaccgtcaaacacctgcacatcttctca
cacacccgtgccagcgaggtcattgatgccctcctccgcaagttcaccgtcatcgacaac
ccccgcaagtttgccctcttcgagaggtctgagaaggatgagcaagtgtatctgcggaag
ctgggtgacgaggagcagcccctgcggctgcggctgctggctggccctagcgagaaggtg
ctgagcttcatcctgaaggagaacgagaccggagaggtgaactgggacgccttcacgctg
ccggagctgcacaacttcctgctgatcctgcagcgggaggaggaggagcacgtgcggcgg
ctgcggcaccgctacgcgcgctgccgccagaagatgcaggaggcgctggccgcgctcacg
ccggggtga

DBGET integrated database retrieval system