KEGG   Lonchura striata domestica (Bengalese finch): 110470411Help
Entry
110470411         CDS       T05897                                 

Definition
(RefSeq) FXYD domain-containing ion transport regulator 6-like
  KO
K13363  FXYD domain-containing ion transport regulator 6
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lsr02000]
    110470411
Transporters [BR:lsr02000]
 Other transporters
  Pores ion channels [TC:1]
   110470411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP1G1_PLM_MAT8 Glycophorin_A EphA2_TM
Motif
Other DBs
NCBI-GeneID: 110470411
NCBI-ProteinID: XP_021385693
LinkDB All DBs
Position
Unknown
AA seq 96 aa AA seqDB search
MEAALIFLCSLLVPAAVADVAAPEKEEEDPFNYDYQSLRIGGLVFAVVLFTVGILLILSR
RCRCSFKQKPRAPGDEEAQAENLITSNATAAQKAEN
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagcgctcatcttcctgtgctccctgctggtccccgcagccgtggccgacgtg
gccgccccggagaaggaggaggaggatccctttaactatgattaccagagcctgaggatc
ggggggctggtgttcgccgtggtcctgttcaccgtgggcattctcctcatcctcagcagg
aggtgcaggtgcagtttcaagcagaagcccagggctccaggggacgaggaggctcaggca
gagaacctgatcacctcgaacgcaacggcggcgcagaaggcagagaactga

DBGET integrated database retrieval system