KEGG   Lonchura striata domestica (Bengalese finch): 110471958
Entry
110471958         CDS       T05897                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00220  Arginine biosynthesis
lsr00330  Arginine and proline metabolism
lsr01100  Metabolic pathways
lsr04020  Calcium signaling pathway
lsr04146  Peroxisome
lsr04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    110471958 (NOS2)
   00330 Arginine and proline metabolism
    110471958 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110471958 (NOS2)
   04020 Calcium signaling pathway
    110471958 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110471958 (NOS2)
Enzymes [BR:lsr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     110471958 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF1400
Other DBs
NCBI-GeneID: 110471958
NCBI-ProteinID: XP_021388719
LinkDB
Position
19
AA seq 1105 aa
MERLPIITSAKPSEGGEVCSQHHGLMNLPSNDIKVSNQISGCPRHVRVRNLENGSSFLDT
LHLTAKEVINCQTKACQGSLMTPKGLVRGTRDGPVPLQDLLPQAIDFLKQYYSSFKEPKI
KEELGRLEAVTKEIETTGTYHLTKDELAFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKT
AKEMFEHICHHIQYATNNGNIRSAITVFPHRTDGQHDFRVWNSQLIRYAGYQMSDGSVLG
DPATVEFTQLCIELGWKPKYGRFDVLPLVLQANGQDPEIFELPPEIVLQVPMEHPKYEWF
KELELKWYALPAVASMLLEAGGLEFPACPFNGWYMGTEIGVRDFCDAQRYNILKEVGRRM
GLETNKLSSLWKDRAVVEINVAVLHSFQKQNVTIMDHHSASESFLKYMQSEYRARGGCPA
DWVWIVPPMSGSITPVFHQEMLNYVLTPFYYYQVDAWKTHVWHDETRRPRKKEIKFSILA
KAVLFASSLMRGAVATRAKVTVIYATETGKSETLANSLCSLFSCAFSTKILCMDEYNICD
LEKETLLLVVTSTFGNGDSPGNGKTLKDSLLRLKLLRNKIRYAVFGLGSSMYPEFCAFAH
AIDQKLAQLGASQLTPVGKGDELNGQEEAFRSWAVSAFKAACDIFNVRGRHSIQLPKIFT
SEERWDPTNYRLVHDSQPMDLAKALANIHAKDVIPMKLKFRQNLQSLKSSRVTILVKLHC
ETDQEVHYLPGEHIGIFPGNQAELVHGIIAHVKDAPPADQTIRLETCIDGGYWASHKKIP
ACTLPEALTYLLDITTPPSQQLLKKLSQLVTAEGDKQRLEVLCQSTEEYNKWKFYNSPNI
LEVLEEFPSAEVSTAFLLTQLPLLKPRYYSVSSSCDLTAREIHLTVAVVNYRTRDGEGPL
HHGVCSTWLNTIELNKTVPCFIRSANEFHLPEEPSKSCVLIGSGTGIAPFRSFWLQRLYD
LEHRGLRGGDMTLLFGCRHPDLDHIYREETEEMKRKGVLRDVYTAYSRLPGQEKVYVQDV
LQGQLAARVCEVLQGQQGHVYVCGDVRMARDVAGALRALLARALRLSQQQASEYFQQLKS
QKRYHEDIFGAVFPHEVKRALQPTS
NT seq 3318 nt   +upstreamnt  +downstreamnt
atggagaggctgcctatcataacttcagcaaagcccagtgagggaggagaagtctgttcc
cagcatcatggtttgatgaatctcccttcaaatgacatcaaagtttcaaaccaaatatca
ggatgtccaagacatgtaagagtaaggaacttggaaaatggatccagctttcttgacaca
ctacacctgactgcaaaagaggttatcaattgccagaccaaagcctgccaagggtcactc
atgaccccaaagggcctggtgagaggtaccagagatgggccagttccactacaggatctt
ttacctcaggcaatagacttcctcaagcaatactacagttcatttaaagagccaaaaatc
aaagaagagctgggccggctggaagcagtgaccaaggagatagaaacaacaggaacttac
cacctgacaaaggatgagctggcctttgctgccaagcaggcctggaggaatgcccccagg
tgcatcgggagaatccagtggtccaacctgcaggtgtttgatgcacgagactgtaaaaca
gccaaggaaatgtttgagcatatctgtcatcatattcagtatgccacaaacaatggtaat
ataaggtcagccatcacggtgttcccgcacaggacggatgggcagcacgatttccgtgtg
tggaacagccagctgatccgctacgctggctaccaaatgtcagatggctctgtccttgga
gaccctgctactgtggagttcactcagttgtgcatcgaacttgggtggaagccaaaatat
ggccgctttgatgtacttccacttgttctccaagcaaatggccaagacccagaaatattt
gaattacctccagaaattgtcctccaagtgccaatggagcatccaaagtacgagtggttt
aaggagctggagctgaagtggtacgcgctgcctgctgtggccagcatgctgctggaggca
ggagggctggagttccccgcgtgccctttcaatggctggtacatggggacggagattggc
gtgcgggacttctgcgacgcgcagcgctacaacatcctgaaggaggtagggaggagaatg
ggactggaaacaaataaactgtcatcattatggaaggaccgagctgttgtagagatcaac
gtggctgtgcttcacagcttccagaaacagaatgtaaccatcatggatcaccactcggcc
tccgagtccttcctgaagtacatgcagagcgagtaccgtgcgcggggcggctgcccagca
gactgggtgtggatcgtgcctcccatgtcaggcagcataacccccgtgttccaccaagag
atgttgaactatgtcctcactcccttctattactaccaggtagatgcatggaaaacacat
gtatggcatgatgagacccgaaggccaaggaaaaaagaaataaagtttagcatcttggca
aaggctgtgctctttgcatcctcactgatgcgaggggcagtggccaccagggccaaggtc
accgtgatctacgcgacagaaacgggcaagtcggagacgctcgccaacagcctgtgcagc
ctgttcagctgtgccttcagcaccaagatcctctgcatggatgagtacaatatttgcgac
ctggaaaaagaaacacttcttttagtggttactagcacttttggaaatggagattctcca
ggtaacggaaagaccttgaaggactctttgctcagactaaaactgctgagaaataaaatt
aggtatgctgtgtttggtctggggtccagtatgtacccagagttctgtgcctttgctcat
gccattgaccaaaaactggcccaactcggggcttcccagctcactccagtgggcaaaggg
gatgaactcaatgggcaagaagaagctttccgcagctgggcagtcagtgctttcaaggct
gcctgtgacatctttaacgtccgtgggagacacagtatacagttgcctaagatcttcacc
tctgaggaaaggtgggaccctaccaattacaggctagtgcatgactcccagcccatggac
ctggctaaagctcttgcaaacattcatgccaaggatgtaattcccatgaagctgaaattt
aggcagaatcttcaaagtttgaagtccagtcgcgtcaccattctggttaaacttcactgt
gagacagatcaggaagtgcactaccttcccggggagcacattgggattttcccaggcaac
caggcagaattagtccatggcattattgcacatgtcaaggatgcccctccagctgatcag
actatcaggcttgaaacctgcattgatggtgggtactgggcaagtcacaaaaagattcca
gcctgcacactacctgaggctttgacatacttgcttgatatcactactccaccctcccaa
caactgctaaaaaaactctcccagctggtgacagcagaaggagacaagcaaaggctggag
gtgctgtgtcagagcacagaagaatacaataaatggaagttttacaacagcccaaacatc
ctggaggtgctggaggagttcccctctgctgaggtctccacagctttcctgctgactcag
ctgccacttctgaagcccaggtactattctgtcagctcctcctgtgacctgacagccaga
gagattcatctgacagttgcagttgtaaactacaggacaagagatggtgaagggcctttg
caccatggagtctgcagcacctggctgaacacaatagagctcaacaaaactgttccctgc
ttcatccgcagtgctaatgagttccacctcccggaggagccatccaagtcctgcgttctg
atcggctcgggcacggggattgctcccttcaggagcttctggctgcagcgcctctatgac
ctggagcacagagggctcagaggaggggacatgaccctgctgttcggctgccggcatcca
gacctggatcacatctacagggaagagactgaggagatgaagaggaagggagtcctgaga
gatgtctacacagcttactccagactgcctggccaagagaaagtgtacgtccaggacgtg
ctgcaggggcagctggcggcccgcgtgtgcgaggtgctgcaggggcagcagggccacgtg
tacgtgtgcggggacgtgcgcatggcgcgggacgtggccggcgcgctgcgggcgctgctc
gcccgcgccctgcgcctcagccagcagcaggccagcgagtacttccagcagctcaagagc
caaaagcgataccatgaagatatatttggggctgtgttcccacatgaagtcaaaagagct
ttgcaacccaccagctga

DBGET integrated database retrieval system