KEGG   Lonchura striata domestica (Bengalese finch): 110472191Help
Entry
110472191         CDS       T05897                                 

Gene name
C8G
Definition
(RefSeq) complement component C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
lsr  Lonchura striata domestica (Bengalese finch)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin
Motif
Other DBs
NCBI-GeneID: 110472191
NCBI-ProteinID: XP_021389331
LinkDB All DBs
Position
Unknown
AA seq 204 aa AA seqDB search
MAALRTLLLVGLLLSARGQRAAQRRRPPPPQSALEKVAAQEGLSLHQLSGKWFLVSIASR
CSYLAEHSHQLEATTVTVTVLEGQSLVINTFRKLDRMCWEIRQHYLSAQAPGHFVLKGHR
KSSKVDVVVGEADPSSFIILYYQKGRSISVKLYSRTSLVSDAVMDKFEQRVRAVGLSEDV
TYYFPTYGFCDSTDEFHVLDETKL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcggccctgcgcaccctcctgctcgtcgggctgctcctttcggcgcgggggcagagg
gcggcgcagcggcggcggccgccccctccccagagtgcgctggaaaaagtagcggctcag
gaggggctcagcctgcaccagctctcagggaagtggttcctggtcagcatagcctcccgc
tgcagctacctggcagagcacagccaccagctggaggccacgacagtgacagtgaccgtc
ctggaagggcagagcctggtcatcaacaccttcaggaagctggacaggatgtgctgggaa
atcaggcagcactacctttctgcccaggcccctggacactttgtgctgaagggccatagg
aaaagcagcaaagtggatgtggtggtgggtgaggctgaccccagcagcttcatcatcctc
tattaccaaaagggccgcagcatctctgttaagctctatagtcggaccagcctggtcagt
gacgccgtcatggacaagttcgagcagcgcgtcagggctgtgggtctgagtgaggacgtg
acctactacttccccacctatgggttttgtgactctacagatgagtttcacgtccttgat
gaaacaaagctgtag

DBGET integrated database retrieval system