KEGG   Lonchura striata domestica (Bengalese finch): 110472925
Entry
110472925         CDS       T05897                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04010  MAPK signaling pathway
lsr04020  Calcium signaling pathway
lsr04260  Cardiac muscle contraction
lsr04261  Adrenergic signaling in cardiomyocytes
lsr04270  Vascular smooth muscle contraction
lsr04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110472925 (CACNA1C)
   04020 Calcium signaling pathway
    110472925 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110472925 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110472925 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    110472925 (CACNA1C)
   04270 Vascular smooth muscle contraction
    110472925 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lsr04040]
    110472925 (CACNA1C)
Ion channels [BR:lsr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110472925 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 110472925
NCBI-ProteinID: XP_021390701
LinkDB
Position
1A
AA seq 2176 aa
MVNENKRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTASSTQRKRQQYGKQKKQGTTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGNSIGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYH
VQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTECKAGWEGPKHGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTDNV
PGADMEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTL
TIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGG
ILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLF
LFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAY
GGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLA
RTASPEKKQEMEKTAVEEETKEEKIELKSITADEESPPATKINVDDYQPNENEEKSPYPT
TEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAVPMPDASAFFIFSPNNRFRVHCHRIVND
NIFTNLILFFILLSSISLAAEDPVRHLSFRNQILGNADYVFTSIFTLEIILKMTAYGAFL
HKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVV
QCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTEAECRGYYITYKDG
EVSQPMIQPRSWENSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHR
VEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPL
RRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCMFKEAMNILNMLFT
GLFTVEMVLKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIV
VGSIVDIAITEVNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLW
TFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFR
CATGEAWQEIMLACLPDKKCDPESEPANSTEADHSCGSSFAVFYFISFYMLCAFLIINLF
VAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFG
KLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKK
IWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSL
QFAVLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNH
VSYYQSDGRSGFPQTFTTQRPLHINKSGNNHGDTESPSHEKLVDSTFTPSSYSSSGSNAN
INNANNTALCRFPSPPSYPSTVSTVEGHGTPLSPTICVQEAPWKLPSKRTHYYETLGRSS
SRDSQLAIVCQEEVSQDETYDENLNEDIEYCSEPSLLSTEMLAYQDDENRQLTPPEHNKG
EDTRHSPKKGFLCSSALGRRASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGLS
PLLQRSHSPTMFSRLCATPPATPCNRGWPQQSIPTLRLDGAESSEKLNSSLPSVHCGSRY
PESGGSPRRARPVSLTVPSPTAGSSRQFHGSASSLVEAVLISEGLMQFAQDPKFIEVTTQ
ELADACDMTIEEMENAADNILNGNSKQSPNGNLLPFANCRDPGQDSAGEEEEEVQNPDCR
ISQEELKDSRIYISSL
NT seq 6531 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacaagaggatgtacattccagaagaaaaccatcaaggttccaactat
gggagtccccgcccagctcatgccaacatgaatgccaatgcagctgcagggcttgcccca
gagcacatccccactccgggggcagctctgtcctggcaggctgccatcgatgctgccagg
caagccaagctgatgggcagtgctggcaacgccacgatatccacggccagctccacgcag
aggaagcggcagcagtatggcaagcagaagaagcagggcaccaccacagccacccgtcct
ccccgggcgctgctgtgcctcacgctgaagaatcccatccggagggcatgcatcagcatc
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagctatctatatcccctttccagaagatgattccaatgccaccaattccaatctggaa
cgagtggaatatctctttctcataatttttacagtggaagcatttttaaaagtaatagca
tacggacttctctttcaccccaacgcttacctccgcaatggctggaatttactagatttt
ataattgtggtagtagggctttttagtgcaattttagaacaagcaaccaaagcagatggg
gggaattcaataggaggaaaaggtgccggattcgatgttaaagcactgcgggctttccga
gtactacgtccactacggctggtgtctggagttcctagtctccaggtggttttaaattca
attatcaaggccatggtccctttgttgcatattgccctgctggtgctgtttgtcattatc
atctatgccatcattggactggagttattcatggggaagatgcataagacctgctaccat
gtgcaagggggactgatagatacacctgcagaagatgatccgtctccgtgtgccccccag
tctgcccatggacggcagtgtcagaacggcaccgagtgcaaggcgggctgggagggaccc
aagcatggcattaccaactttgacaattttgcttttgccatgctcacggtgtttcagtgc
atcaccatggagggctggacagatgtgctgtactggatgcaggacgctatgggctatgag
ttaccatgggtgtattttgtcagtctggtcatctttggatcctttttcgttctaaatctg
gttcttggtgtgttgagcggggagttttccaaagaaagagaaaaggctaaagctcgaggt
gatttccagaagctacgggaaaagcagcagctcgaggaggatctgaagggatatttagac
tggataactcaagcagaagatattgatccagaaaatgaagatgaaggcatggatgaggag
aagcctcgaaacatgagcatgcccaccagcgagaccgagtccgtgaacaccgacaacgtc
cccggagcagatatggaaggcgagaactgcggcgcaaggctggcgcatcggatctcaaaa
tcaaaatttagtcgctactggcgccgatggaatcgattctgcagaaggaagtgccgtgct
gctgtcaagtccaatgttttctattggctggtgatcttcctcgtgtttctcaacactctc
accattgcctctgagcactacaaccagccagactggctcacggaggtccaagacactgcc
aataaggtgctgctagctcttttcacggcagagatgctgctgaagatgtacagccttggt
ctccaggcctactttgtgtccctgttcaaccgctttgactgtttcattgtgtgtggaggc
atcttggaaaccatcctggtggagacgaagatcatgtcaccgctgggcatttcggttttg
agatgtgtgagactcctaagaatatttaaaatcacaagatattggaactccctgagtaat
cttgtggcttcacttctgaattcagtccgctccattgcttccctgttgctgcttctcttc
ctcttcatcatcatcttctcactcctggggatgcagctctttgggggcaagtttaacttt
gatgagatgcagaccaggaggagtacatttgacaacttccctcagtccctcctgactgtg
ttccagatcctgactggggaggactggaattcggtgatgtatgatgggatcatggcttat
ggcggcccctcttttccaggaatgttggtctgtatttacttcatcatcctcttcatctgt
ggaaactatatcctcctgaatgtatttttggccattgctgtggacaaccttgctgatgct
gagagtttaacatctgcacagaaagaggaggaagaggaaaaagaaaggaaaaagctagct
aggactgctagtccagaaaagaaacaggagatggaaaaaacagctgtggaggaagagaca
aaggaggagaaaattgagctgaaatcgatcactgctgatgaagagtccccacctgctacc
aagatcaacgtggatgattatcagcccaatgaaaatgaagaaaagagcccttatcccaca
acagaagcaccagcagaggaagatgaggaagaacctgagatgcctgtcggccctcggcct
cgcccgatgtctgagctgcacctcaaggaaaaggctgtgcccatgcctgatgccagtgct
tttttcatcttcagtcctaacaacaggtttcgtgtccactgccatcgaatcgttaatgat
aacattttcaccaacctgatcctgtttttcatcttgctcagcagcatctccctggcagct
gaggaccccgtgcgacacctctcctttaggaaccaaatcctaggcaatgcagactatgtc
ttcactagtatctttacattagaaattattcttaagatgaccgcctatggggctttcctc
cacaagggctccttctgcaggaactatttcaacatcttagacctgctggtggtcagcgtt
tcgctcatctcctttggcatccagtccagtgccattaatgtggtgaagatcctgcgtgtt
ctgcgggtccttagaccactgagggccatcaaccgagccaaaggactaaagcacgtggtc
cagtgtgtgtttgtcgccatccgaaccatcgggaacattgtgattgtcaccactttgctg
cagttcatgtttgcctgcattggagttcagctgtttaagggcaagctgtacagctgcact
gacagctccaagcagacagaagcagaatgcagagggtactacatcacctacaaggatggg
gaggtcagccagcccatgatacagccccggagctgggagaacagcaagttcgacttcgac
aatgtcctcactgccatgatggccctcttcaccgtctccacctttgagggctggccagag
ttgctgtataggtccattgattcccacatggaggatgtgggacccatctataatcacagg
gttgagatctccatcttctttattatctacatcatcatcattgctttcttcatgatgaac
atcttcgttggtttcgtcatcgtcacatttcaggaacaaggagaacaagagtacaagaac
tgtgagctggacaaaaaccagcgccagtgtgtagagtatgccctgaaagcccggcctctg
cggagatacatccctaaaaaccagtaccagtacaaagtttggtatgtggtcaactccacc
tactttgaatacctgatgttcgttctgatcctgctgaacaccatctgcctggccatgcaa
cactatggtcagagctgcatgttcaaggaagccatgaatatcctcaacatgctcttcacc
ggcctcttcactgtggagatggtcctgaaattaatcgccttcaaacccaagggttacttt
agtgatccttggaatgtttttgacttcctcatcgtaattggcagcattatagacgtcatt
ctcagtgaaactaatcactatttctgtgatgcatggaatacatttgacgccttgattgtt
gtgggtagcattgttgatatagcaatcaccgaggtgaacccagctgaacatacccaatgc
tcttcctctatgaacgcagaggaaaactctcgcatctcaatcaccttcttccgactcttc
cgcgtgatgcgtctcgtgaagctcctgagccgaggggagggcatccggacactcctttgg
accttcatcaagtccttccaggctctcccctacgtggctcttttaatagtgatgctgttc
ttcatctacgctgtgattgggatgcaggtgtttggtaaaattgcgctgaacgataccaca
gaaatcaaccgcaacaataacttccagaccttcccccaggcagtgctgctgcttttcagg
tgtgccacaggtgaggcctggcaggaaatcatgctggcatgtctccccgacaagaagtgc
gacccggagtctgagccggccaactccacagaagccgatcactcgtgtggcagcagcttc
gctgtcttctatttcatcagcttctacatgctctgtgccttcctgatcatcaatcttttt
gtagctgttataatggataactttgattacctgacacgggactggtccattttaggacca
caccacctggatgagtttaaaaggatctgggcagagtatgaccctgaagctaagggacgg
atcaaacacctggacgtggtgaccctgctccggcggatccagcctccgctgggctttggg
aagctctgccctcaccgagtggcttgcaaacgccttgtctccatgaatatgccactgaac
agcgatgggactgtcatgttcaatgccactctctttgcattggtcagaacagcactgagg
atcaagacagaaggtaacctggagcaagccaacgaagagctgagagcaataattaagaaa
atctggaaacgcaccagtatgaagctgctggaccaggtggtgcctcctgcaggtgatgac
gaggtgacagtggggaagttctacgccactttcttgatccaggagtatttccggaagttc
aagaagcgtaaagagcaggggctggtggggaagccctcgcagcgcaacgcgctgtcctta
cagtttgctgttttgcaggctggtctgcgcacactccacgacattgggcccgagatccga
cgagccatttctggagacctgacagctgaagaagagctggacaaggccatgaaagaagct
gtttctgctgcctctgaagatgatatcttccggagagctggaggcttgtttggtaaccat
gtgagctattaccaaagtgacggcaggagtgggttcccccagacattcaccacccagaga
cctttgcacatcaacaaatctggcaacaaccatggagataccgagtctccatctcatgag
aagctggtggactcgaccttcacgcccagcagctactcatcttcaggctccaatgccaac
atcaacaatgccaacaacacggctctgtgtcgctttcccagcccacccagctaccccagc
actgtcagcacggtggaaggccatgggacccccttgtcacctaccatatgtgtgcaggag
gctccctggaaactcccatccaaaaggacacattactacgagacactgggacgctccagt
tccagagacagccagctggcaattgtttgccaagaggaagtgtctcaggatgagacttac
gatgaaaatttgaatgaagacattgagtactgtagtgaaccaagtctgctctctaccgaa
atgcttgcataccaagatgatgaaaacagacaactcactccaccagaacacaacaaagga
gaggacacccggcactctccgaagaaggggtttctgtgctcctcagctctaggtcgaaga
gcatcttttcacttagagtgtttgaaaagacagaaaaaccagggtgtggatgtctcacag
aagacagtcctacctttgcatctggtccatcatcaggcattagcagtggccggcctgagt
cccctgctccagcgaagccattcccccaccatgttctctcggctgtgtgctacgcccccg
gccacgccttgcaaccggggctggccgcaacagagcatcccaacgctgcgcctcgacggg
gccgagtcctcggagaagctcaacagcagcttgccgtcggtgcactgcggctcccggtac
ccggagagcggcggcagccccaggagagcccggccggtgtccctgaccgtgcccagcccg
accgcagggagcagccggcagttccacggcagcgccagcagcctggtggaagcggtcttg
atttcggaaggactgatgcagtttgctcaagatccaaagttcattgaggtcacaacccag
gagctcgcagacgcctgcgacatgacgatagaagagatggaaaatgcagcagacaacatt
ctcaatggtaacagcaagcagagccccaatggcaacctcttgccttttgctaactgcagg
gacccagggcaggacagtgcaggagaggaagaggaagaggtgcagaacccggattgtagg
ataagtcaggaggagctcaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system