KEGG   Lonchura striata domestica (Bengalese finch): 110472989
Entry
110472989         CDS       T05897                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04012  ErbB signaling pathway
lsr04068  FoxO signaling pathway
lsr04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110472989 (CDKN1B)
   04068 FoxO signaling pathway
    110472989 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110472989 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110472989
NCBI-ProteinID: XP_021390874
LinkDB
Position
1A
AA seq 219 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNREFKKHLQEMEEMYQRKW
NFDFQNHRPLEGRYEWQAVEKGSSPDFYFRPPRLRKAVCKSAGRQSLDVNGNCQTVVFVG
SQGISEDTHCVAQKTDVSENQTDLAEQCTAQRKRPAADGNVPHGSAPRPTRVSAGAPALP
PLPRVAPARCAHHPRPFPSKKARVVLAVPGVPPRVGAGR
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgcatttctaatgggagccctaccctggagcgcatggaggccaggcag
tcggagtacccgaagccgtcagcgtgccggaacctcttcgggccggtgaaccacgaagag
ctcaacagggaatttaagaaacacctgcaggagatggaggagatgtaccagaggaagtgg
aatttcgatttccagaatcacaggccgctggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgacttctacttcagacccccccggctacggaaagccgtctgcaag
tccgccggccgccagagcttggatgtaaacgggaattgccaaaccgtggtttttgtcggt
tctcagggaatctcagaggacactcactgtgtagctcaaaagactgatgtttcagaaaat
cagacggacttagcagagcagtgcactgcccagaggaaaagacccgcagccgatggtaac
gtaccccacggctctgccccgcgtcccactcgtgtcagcgccggcgctccagcccttccg
cccctgccacgcgtggcaccggctcggtgtgcccaccacccccgcccctttccctctaaa
aaagcccgggtagtgttggcagtcccgggggtcccgcctagagtgggagccggtagatga

DBGET integrated database retrieval system