KEGG   Lonchura striata domestica (Bengalese finch): 110473068Help
Entry
110473068         CDS       T05897                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04012  ErbB signaling pathway
lsr04068  FoxO signaling pathway
lsr04110  Cell cycle
lsr04115  p53 signaling pathway
lsr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110473068 (CDKN1A)
   04068 FoxO signaling pathway
    110473068 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110473068 (CDKN1A)
   04115 p53 signaling pathway
    110473068 (CDKN1A)
   04218 Cellular senescence
    110473068 (CDKN1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 110473068
NCBI-ProteinID: XP_021390998
LinkDB All DBs
Position
Unknown
AA seq 151 aa AA seqDB search
MPLSQSRAGQSPCGSKACRNLFGPVDHEQLQQDFEDNIKQQLEEAQQRWNFNFETETPLE
GPFKWERILVAEQPPQEVHSLVRAVISSDSRSSLAHRVPPKDRVGRICPEETQQSSKVYK
AGSLQSLKRGQTTIKDFYSSKRRIVPARPQP
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgtcccagagcagggctgggcagagcccctgtggcagcaaggcctgcaggaac
ctcttcggccccgtggaccacgagcagctccagcaggactttgaggacaacataaaacaa
cagctggaagaagctcagcagcgctggaacttcaactttgagacagagactcccttggaa
gggccgttcaagtgggagaggatcctggtggctgagcagccaccccaggaggttcacagc
ctggtcagggctgtcatcagcagtgacagcaggagctccttggcccacagggtccccccc
aaggaccgtgttggcaggatttgccctgaggagactcagcagagctcgaaggtttacaag
gctggttccctgcagagcttgaaacgtgggcagaccacgatcaaagacttctacagctcc
aagaggaggatcgtccctgcccggccccagccgtga

DBGET integrated database retrieval system