KEGG   Lonchura striata domestica (Bengalese finch): 110475373Help
Entry
110475373         CDS       T05897                                 

Definition
(RefSeq) carbonyl reductase [NADPH] 1-like
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00590  Arachidonic acid metabolism
lsr00790  Folate biosynthesis
lsr00980  Metabolism of xenobiotics by cytochrome P450
lsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110475373
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    110475373
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110475373
Enzymes [BR:lsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     110475373
    1.1.1.189  prostaglandin-E2 9-reductase
     110475373
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     110475373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_4 HATPase_c ThiS
Motif
Other DBs
NCBI-GeneID: 110475373
NCBI-ProteinID: XP_021395143
LinkDB All DBs
Position
Unknown
AA seq 276 aa AA seqDB search
MSSVQVAVVTGSNKGIGLAIVRSLCKQFPGDVYLTSRDPGRGQAAVAQLQQEGLRPLFHQ
LDIDDLQSIRALRDFLKEKYGGINVLVNNAGIAFKVHDTTPFAVQAEVTLKTNFFGTRNV
CTELLPLMKPYGRVVNVSSMVSCSALRGCSQELQQKFRSDTITEDELVQLMAKFVEDTKR
SVHDKEGWPNTAYGVSKIGVTVLSRIQARLLNEQRKGDHILLNACCPGWVRTDMAGPKAT
KSPDEGAETPVYLALLPSSADAPHGQFVSDKTVKPW
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtgtgcaggtggctgtggtgacaggctccaacaaagggattggcttggccatc
gtgcggtccctgtgcaagcagttcccaggggatgtgtacctgacctcccgggatcccggc
cgtggccaggctgccgtggcacagctccagcaggaagggctgcgcccactcttccaccag
ctggacatcgatgacctgcagagcatccgagcgctccgggacttcctgaaggagaagtat
ggagggatcaacgtgctggtgaacaacgctggtattgctttcaaagtccatgacaccact
ccatttgcagtccaagctgaggttaccctgaagacaaacttctttggaaccaggaatgtt
tgcacagaattgctgcctctcatgaagccttatggtcgggtggtgaacgtctccagcatg
gtgagttgctcagccctgagaggctgcagccaggagctgcagcagaaattccgcagtgac
accatcactgaggatgagctggtgcagctcatggccaaattcgtggaagacaccaagaga
agtgtccatgacaaagagggttggccaaacactgcctatggggtgtccaaaatcggggtc
accgtcttgtccaggatccaagcgcggctgttgaacgagcagaggaaaggtgaccacatc
ctcctcaatgcctgctgccccggctgggtcaggacagacatggcaggtcctaaggccacc
aagtcccccgatgagggggctgagacccccgtgtatttggcccttttgccttccagtgct
gatgctcctcacggccaatttgtcagtgacaaaactgtcaaaccctggtga

DBGET integrated database retrieval system