KEGG   Lonchura striata domestica (Bengalese finch): 110476356
Entry
110476356         CDS       T05897                                 

Gene name
NAT1
Definition
(RefSeq) arylamine N-acetyltransferase 1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00232  Caffeine metabolism
lsr00983  Drug metabolism - other enzymes
lsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    110476356 (NAT1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110476356 (NAT1)
Enzymes [BR:lsr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     110476356 (NAT1)
SSDB
Motif
Pfam: Acetyltransf_2
Other DBs
NCBI-GeneID: 110476356
NCBI-ProteinID: XP_021396907
LinkDB
Position
11
AA seq 290 aa
MNLEEYFARTGYKGSTEKQDLETLTDIFQHHIRAVPFENLSIHCGEKITLELEHVYNKIV
RRKRGGWCMENNQLLGWVLRGLGYETSFLGAYVFNPHQNAYATLMTHLVVKVVIDGKAYV
VDGGFGVSYQMWQPMELVSGKDQPQAPGVFRFTEKNGVWYLEKMRRKQYIPNQSFSNSDL
LEKKECRKVYMFSLEPRTVEDFRFQCTYLQTSPDSLFTKKSICTLQTTDGFRALIGWTLT
ETTYNYKENMDLVEFVTLEDEEVEKTLKEKFNITLERKLVPINVKGSYTI
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaaccttgaagagtattttgcaagaactggctataaaggctccactgaaaaacaagat
ttggaaaccttaaccgatatattccagcatcacatccgtgccgttcccttcgaaaacctc
agcatccactgtggggagaaaattactttggagttggaacacgtttacaacaagattgtg
cggaggaagcggggtggctggtgcatggagaacaaccagctgctgggctgggtgctgagg
ggcctggggtatgagaccagcttcctgggagcctacgtgttcaacccccaccagaacgcc
tacgccaccctcatgacccacctggtggtaaaggttgtcatcgatggcaaagcctacgtc
gttgatggaggcttcggggtgtcctaccagatgtggcagcccatggagctcgtgtcaggg
aaagaccagccccaggctcccggcgttttccgcttcacagagaaaaacggtgtctggtac
ctggagaaaatgagacggaaacaatacatccccaatcagagcttctccaactctgatctg
ctggagaaaaaagagtgtcgcaaagtttatatgttcagccttgagccacggacagtggaa
gatttccgcttccagtgcacatacctccagacatctccagattccctcttcacaaagaag
tccatctgcaccctccagacaaccgatggattccgagcgctaattgggtggacgctcact
gagaccacgtacaactacaaggaaaacatggatctggtggaatttgtaactcttgaagat
gaagaggtggaaaaaaccctcaaagagaaatttaacatcaccctagagagaaaacttgtc
cccattaatgttaaaggatcttacacaatctag

DBGET integrated database retrieval system