KEGG   Lonchura striata domestica (Bengalese finch): 110478171Help
Entry
110478171         CDS       T05897                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00010  Glycolysis / Gluconeogenesis
lsr00053  Ascorbate and aldarate metabolism
lsr00071  Fatty acid degradation
lsr00280  Valine, leucine and isoleucine degradation
lsr00310  Lysine degradation
lsr00330  Arginine and proline metabolism
lsr00340  Histidine metabolism
lsr00380  Tryptophan metabolism
lsr00410  beta-Alanine metabolism
lsr00561  Glycerolipid metabolism
lsr00620  Pyruvate metabolism
lsr01100  Metabolic pathways
Module
lsr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110478171 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    110478171 (ALDH2)
   00620 Pyruvate metabolism
    110478171 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110478171 (ALDH2)
   00561 Glycerolipid metabolism
    110478171 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110478171 (ALDH2)
   00310 Lysine degradation
    110478171 (ALDH2)
   00330 Arginine and proline metabolism
    110478171 (ALDH2)
   00340 Histidine metabolism
    110478171 (ALDH2)
   00380 Tryptophan metabolism
    110478171 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110478171 (ALDH2)
Enzymes [BR:lsr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110478171 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DtxR
Motif
Other DBs
NCBI-GeneID: 110478171
NCBI-ProteinID: XP_021400328
LinkDB All DBs
Position
Unknown
AA seq 520 aa AA seqDB search
MLRAVVRGSRLCPALLRAPFSAAAASPIPAPNPRPDIAYNKIFINNEWHDAVSKKTFPSI
NPATGEVICQVAEGDKADVDKAVKAAQAAFQLGSPWRRMDASHRGKLLNRLADLIERDRA
YLAALETLDNGKPYAISYLVDLDMVVKCLRYFAGWSDKFHGKTIPLDGDFFCYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLSALYVASLIKEAGFPPGVVNI
IPGFGPTAGAAISSHMDIDKVAFTGSTEVGHLIQKAAAESNLKRVTLELGGKSPNIIMSD
ADMDWAVDQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSVEKAKARVVGNPFDFKTE
QGPQVDEEQFKKILGYISTGQREGAKLLCGGSPAADRGYFIQPTVFGDVQDSMTIAREEI
FGPVMQILKFRTIEEVIQRANDSKYGLAAAVFTRDLDKANFVSQSLRAGTVWINCYDVFG
AQAPFGGYKASGNGRELGEYGLEAYVEVKNVTIKIPQKNS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggcggtggtgcgcggctcccggctctgcccggccctgctccgggctcccttc
tcggccgccgccgcctcccccatcccggcgcccaacccgcgccccgacatcgcctataac
aagattttcataaacaacgaatggcacgatgcagtcagcaagaaaaccttcccctccatc
aacccagccacaggagaagtcatctgccaggtggctgagggcgataaggcagatgtggac
aaggcagtgaaggcagcccaggcagcgttccagctgggctctccctggaggaggatggat
gcgtctcaccgcgggaagctgctgaaccgtctggctgacctgatcgagagggaccgcgcc
tacctggccgccctggaaactctggataatggcaaaccctacgccatctcctacctggtg
gatttggacatggtggtcaaatgtctcagatactttgcaggctggtcagataaattccat
ggcaaaaccatcccgttagatggagacttcttctgctacacaagacatgagcctgtggga
gtctgtgggcaaattatcccgtggaacttcccactgttgatgcaagcatggaaactgggg
cctgccctggccactgggaatgtggttgtgatgaaagtggcagagcaaacccccctgagt
gctctctatgtggccagtctgatcaaagaggctggattccccccgggcgtggtgaacatc
atccctggcttcgggcccacggcaggagctgccatctcctcccacatggacattgacaaa
gtggccttcaccggctccacggaggttggacacctgatccaaaaggctgcagcagagagt
aacctcaagagggtgaccctggagcttggagggaagagcccaaatatcatcatgtctgat
gcagacatggactgggctgtggatcaagcccactttgccctgttcttcaaccaagggcag
tgctgctgtgcagggtccaggacctacgttcaggaggacatttacaacgagtttgtggag
aggagcgtggagaaggccaaggccagggtggttggaaacccctttgacttcaaaacagag
caggggcctcaggtggatgaggagcagttcaagaagatcctgggctacatcagcaccggg
cagcgggagggagccaagctgctgtgtggtggcagccccgctgcagacaggggctacttc
atccagcccacggtctttggggacgtgcaggacagcatgaccatcgccagggaggagatc
tttgggccggtgatgcagatcctgaaattcagaaccatcgaggaggtgattcagagagcc
aacgactccaagtacggcctggcagccgccgtgttcaccagggacctggacaaagccaac
tttgtgtcgcagagcctgagggctggcacagtctggataaactgctacgacgtgtttggt
gcccaagctccctttggaggctacaaagcctctgggaatgggagggagctgggggagtac
ggcctggaggcttatgtggaggtgaaaaatgtgacaatcaaaattccacagaaaaactcc
taa

DBGET integrated database retrieval system