KEGG   Lonchura striata domestica (Bengalese finch): 110478619
Entry
110478619         CDS       T05897                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04010  MAPK signaling pathway
lsr04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110478619 (TGFA)
   04012 ErbB signaling pathway
    110478619 (TGFA)
SSDB
Motif
Pfam: DUF1180 FAM176
Other DBs
NCBI-GeneID: 110478619
NCBI-ProteinID: XP_021401061
LinkDB
Position
22
AA seq 162 aa
MAGGPAALALGVLLAACHALDNSTAGRSAPVAAAVRSHFHECPDSHRHFCFHGSCRFLVQ
EEKPACVCHSGYVGTRCEHADLLAVVAATQKKQTITALLVVAVVASALLVTVCVLVHCCR
LRKRCPCPCPCPGWCREPGAGPEKPAGLLKGGASCCHSDTGV
NT seq 489 nt   +upstreamnt  +downstreamnt
atggcgggcggcccggccgcgctcgccctcggtgtcctgctggccgcgtgccacgcgctg
gacaacagcacggccggccggagcgctccggtggcggcggccgtgcggtcgcacttccac
gagtgccccgactcgcaccggcacttctgcttccacggctcctgccgcttcctggtgcag
gaggagaaacccgcctgcgtgtgtcactcggggtacgtggggacacgctgcgagcacgct
gacctgctggccgtggtggcagccacccagaagaagcagaccatcacggccctgctggtg
gtggccgtggtggcctcggcgctgctcgtcaccgtctgcgtcctggtgcactgctgccgc
ctgcggaagcgctgtccctgtccctgtccctgtcccggttggtgccgcgagcccggagcc
ggccccgagaaaccggcggggctgctcaaggggggagcgtcctgctgccacagcgacaca
ggtgtgtga

DBGET integrated database retrieval system