KEGG   Lonchura striata domestica (Bengalese finch): 110478845
Entry
110478845         CDS       T05897                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04010  MAPK signaling pathway
lsr04137  Mitophagy - animal
lsr04210  Apoptosis
lsr04218  Cellular senescence
lsr04620  Toll-like receptor signaling pathway
lsr04621  NOD-like receptor signaling pathway
lsr04622  RIG-I-like receptor signaling pathway
lsr04623  Cytosolic DNA-sensing pathway
lsr04625  C-type lectin receptor signaling pathway
lsr04920  Adipocytokine signaling pathway
lsr05132  Salmonella infection
lsr05164  Influenza A
lsr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110478845 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110478845 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    110478845 (RELA)
   04218 Cellular senescence
    110478845 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110478845 (RELA)
   04621 NOD-like receptor signaling pathway
    110478845 (RELA)
   04622 RIG-I-like receptor signaling pathway
    110478845 (RELA)
   04623 Cytosolic DNA-sensing pathway
    110478845 (RELA)
   04625 C-type lectin receptor signaling pathway
    110478845 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110478845 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110478845 (RELA)
  09172 Infectious disease: viral
   05164 Influenza A
    110478845 (RELA)
   05168 Herpes simplex virus 1 infection
    110478845 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lsr03000]
    110478845 (RELA)
Transcription factors [BR:lsr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    110478845 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 110478845
NCBI-ProteinID: XP_031363427
LinkDB
Position
Unknown
AA seq 469 aa
MEDVPPTIRVNNYRGPGRVRVSLVTKDPPHRPHPHELVGKDCRDGFYEAELSPERSVHSF
QNLGIQCVKKRELEAAVAERIRTNNXXXXVPAEQRGGEYDLAAVRLCFQVWVRGPGGLQP
LPPVLSQPIYDNRAPSTAELRICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFSAEGWE
AKGSFAQADVHRQVAIVFRTPPFRDPALRAPVTVRMELQRPSDRQRSAPLDFRYLPHQGD
LQCIEEKRKRTRETFRSFIQRSPLPAPASGESRPPRRLAVPSRPPPAPQNPPSAAPSFSF
GGPGGLLGGPAPPEPEPLAEALLQLQFEEGSPQLGGSGTAPPLDLGALLGGGDSPFPALD
PLNACEVQRLLGPPEPPPSFGDPSPDFGAGVPEPPPPPPDFGGPPMLMSYPEAIARLVQS
QPPGAPPEMGLGAELAGGPELGGLGGPEESLPSLGELDLSTFLSQFPSS
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggaggacgtgccccccaccatccgcgtgaacaactaccggggcccggggcgcgtgcgg
gtgtcgctggtgaccaaggaccccccgcaccgcccgcacccccacgagctggtgggcaag
gactgccgggacggcttctacgaggccgagctgagccccgagcgcagcgtgcacagtttc
cagaatttggggatccagtgtgtgaagaagcgggagctggaggcggccgtggccgagcgg
atccgcaccaacaacaannnnnnnncagtgccggcggagcagcgcgggggcgagtacgac
ctggccgcggtccggctctgcttccaggtgtgggtgaggggcccgggggggctgcagccc
ctcccccccgtcctgtcccagcccatctacgacaaccgtgcccccagcacggccgagctc
cggatctgccgcgtgaaccgcaactccgggagctgccggggcggggacgagatcttcctg
ctgtgtgacaaggtccagaaagaggacatcgaggtgcgtttctcggccgagggctgggag
gccaagggctccttcgcgcaggccgacgttcaccgccaggtcgccatcgtgttccgcacg
ccgccgttccgggaccccgcgctgcgcgcgcccgtcaccgtgcgcatggagctgcagcgg
ccctcggaccggcagcgcagcgcgccgctcgacttccgctacctgccccaccagggggac
ctgcagtgcatcgaggagaagcgcaagcggacgcgggaaaccttccgctccttcatccag
cgcagccccctgcccgctccggcgtccggcgagtcgcggcccccccggcgcctggcggtg
ccctcgagaccccccccggccccccagaacccccccagtgcagctccctccttctccttc
gggggtcccggggggctcctggggggcccggccccccccgagccggagcctttggccgag
gcgctgctgcagctgcaatttgaggaggggtccccccagctcggggggagcggcacggcc
cccccgctggatttgggggcgcttctgggggggggggactcccccttccccgccctggac
cccctcaacgcctgcgaggtccagcgcctgctgggcccccccgagccccccccgagcttt
ggggacccctccccggatttcggggcgggggttcccgagccgcccccgccccccccggat
ttcgggggcccccccatgttgatgtcgtaccccgaggccatcgcccgcctggtgcagagc
cagcccccgggggcgccccccgaaatggggctgggggccgagctggccgggggtcccgag
ctgggggggctgggggggcccgaggagtcgctgccctcgctgggggagctggacttgagc
accttcctcagccagttcccctcctcctga

DBGET integrated database retrieval system