KEGG   Lonchura striata domestica (Bengalese finch): 110478957
Entry
110478957         CDS       T05897                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04010  MAPK signaling pathway
lsr04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110478957 (CACNA1E)
   04020 Calcium signaling pathway
    110478957 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lsr04040]
    110478957 (CACNA1E)
Ion channels [BR:lsr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110478957 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 110478957
NCBI-ProteinID: XP_021401591
LinkDB
Position
8
AA seq 2404 aa
MLGFGTCSVGAPARAAELDAASSRCILALPEEETWRQHRLGLMQNTHSCNLLEPQSLAQA
LVSRAASFDALYDGRCREGEAQAGAVQLGLGQLVPVSPDLIKRRRGGLIEQRDIIKAHEA
HKMQSTPQARRKEWEMARFGEAVAGRLGSGDGGSDQNRSRQGAPAPAGGSPGAFKQTKAQ
RARTMALYNPIPVRQNCFTVNRSLFLFGEENIVRKYAKKLIDWPPFEYMILATIIANCIV
LALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDF
IVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIG
LLLFFAILMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECREWIGP
NDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNL
VLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTS
ALDVLRRATIKRNRTDAMSGDEHCVDIASVGERRLAQRRRLNPTLGNPSSQSGLKGARVD
GASYLRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPAWLTHFLYYAEF
LFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRPGTSFGISVLRA
LRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFMD
GTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIYFIVLTLFGNYT
LLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPAIERDRRRR
HHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINKDEPPLINPHASIFR
RKRPGEGVTLEKCAEEQAKAEREGPEQPVPGANPGGGEDRTSPRAKRDMWQQKSCHGNCE
PGEQDGAGGSIEDRARMRQSQRRSRHRRARMEGKDTAGILGSRSASQEMGLEEASTAEGA
QDGDRTAAEALIPGEPEASGDSIRTNGVPAGDADLIGTAKKGSPPHAAPELSQGKAGNLT
EQDCSSPDTSEQALLEPRRSVSRSEPDLSSITPNTEKATESTAIMIDVHDSAVVQISNKT
DGEASPLKEAETKEDEEEMEKKKRKKEKSETGKAMVPHSSMFIFSTTNPVRRACHYIVNL
RYFEMCILLVIAASSIALAAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMVIKMIDQGLIL
QDGSYFRDLWNILDFIVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRL
PKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTQKDCIGN
YVDHEKNKMEVKCREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPS
RSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAIS
AKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTYELALKY
LNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDTKVKQGWEQWA
VGWWWELPPPSDPLISSQLVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFK
ALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLGSLMLLFRSATGEAW
QEIMLSCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDN
FEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRISYKDMYKLVRVISPPLGLGENCPYRV
ACKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKEILTIWPH
LSQKMLDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPS
SLPQEIISNAKALPYLQQDTLSGLSSRGGFPSLSPLSPQEIFQLACMDPAQEQFQEHQSL
VVTDTSSMRRSFSTIRDKRPNSSWLDEFSMERSSDNTYKSRRRSYHSSLQLSARRLNADS
GHRSEGHRSGRERGRSKERKHLLSPDISRCNSEERSPQAQEESPERRRESRSPSEGRSQT
PSRQGMGSLSESSIPSISDTSTPRRGRRQLPPVPPKPRPLLSYASMLRHAGDTSPPADES
EGGSPLLSSSLDPSTAGPAESSSSPVAGKQSRQSTPQRYISEPYLALHDDSHASDCGEEE
TLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGAAQGVMCGASIDVLSDTEE
DDKC
NT seq 7215 nt   +upstreamnt  +downstreamnt
atgctggggttcgggacgtgctccgtgggcgccccggcgagggcggctgagctggacgcc
gcctcgtcccgctgcatcctggccctgcccgaggaggagacgtggcgccagcaccgcctg
ggcctgatgcagaacacccattcctgcaacctgctggagccccagagcctggcccaggcg
ctggtgtcccgcgccgcctccttcgacgccctgtacgatggccgctgccgcgagggcgag
gcgcaggccggtgccgtgcagctggggctgggccagctggtgcccgtcagccccgacctg
atcaagcgccggcggggaggcctcatcgagcagagggacatcatcaaggcacacgaggca
cacaagatgcagagcacgccccaggcacggaggaaggagtgggagatggctcgctttggg
gaggcggtggccggcaggctgggctccggagatgggggctccgaccagaaccggagccgg
caaggagctcctgcccctgcgggaggcagcccgggagccttcaagcaaaccaaagcgcag
agagcccggactatggctctgtacaaccccatccccgtccggcagaactgcttcaccgtc
aacagatcgctcttcctcttcggggaagagaacatagtcaggaaatacgccaagaagctc
atcgactggcctcccttcgagtacatgatcctggcgaccatcattgccaactgcatcgtg
ctggccctggagcagcacctccccgaggatgacaagacgcccatgtcacggagattagag
aagacagagccctacttcattgggattttctgcttcgaggctgggattaagattgtagcc
ctggggttcgttttccacaagggctcgtacctgcgcaacggctggaacgtcatggacttc
atcgtggtcctcagcggcatcctcgccacggccgggacacacttcaacacccacgtggac
ctgcggacgctgcgcgccgtgcgcgtgctcaggcccctgaagctcgtctcgggcattccc
agcttgcagattgtcctgaaatccatcatgaaggccatggtgcctctcctgcagatcggc
ctgctgctcttttttgctatcctcatgtttgccatcatcggcctggagttctacagtggg
aagctgcaccgagcctgctacacaaacaattcaggtgaactggaggagctggaccctccc
catccctgcggggtgcagggttgccccccgggctacgagtgccgggagtggatcggtccc
aacgacgggatcacgcagttcgacaacatcctcttcgccgtgctgaccgtcttccagtgc
atcaccatggaagggtggaccacagtcctgtacaacaccaatgatgccttaggagccacc
tggaactggctgtacttcatccccctcatcatcattggatccttcttcgtcctcaacctt
gtcctgggagtgctgtcaggggagtttgccaaagagagagagcgcgtggagaaccgccga
gccttcatgaagctgcggcgccagcagcagatcgagcgggagctcaacggctaccgggcg
tggatagacaaagcggaggaagtcatgctggccgaagagaacaaaaattcggggacctca
gccttagacgtgctcaggcgagccaccatcaagcggaaccgcacggatgccatgtcgggt
gacgagcactgtgtcgacatcgcctccgtgggcgagcggaggctggcgcagaggagacgt
cttaatccaaccttgggtaacccctcaagtcaatctggcctcaaaggtgccagggtggac
ggtgcctcctacttgcggcacaaggagcggctccttcgcatctctgtccgccacatggtc
aaatcccaggtcttctactggatcgtcctgagcctggtggctctcaacactgcctgcgtg
gccatcgtccatcacaaccagccagcctggctcacccacttcctctactatgcagagttc
ctgtttcttgggctcttccttctggagatgtccttgaagatgtacgggatggggccacgc
ctttacttccattcttccttcaactgcttcgactgtggggtcacagtgggaagcatcttt
gaagtggtttgggctatattcaggcctggaacctcttttgggatcagtgtcctacgagct
cttcgtctcctgcggatatttaaaataaccaagtactgggcatccctgaggaatttggtg
gtctcgctgatgagctccatgaaatctattatcagtctgctcttcctcctcttcctcttc
attgtagtctttgccctgctgggaatgcagctgtttggaggcaggtttaacttcatggat
gggactccctcggccaactttgacaccttccctgcagccatcatgacggtgtttcagatc
ctgacgggcgaggactggaacgaggtgatgtacaacggcatccgctcccagggaggtgtg
cgctcagggatgtggtcctccatctacttcatcgtcctcaccttgtttgggaactatact
ctgctgaatgtcttcttggccattgccgtggacaacctggccaacgctcaggagctcacc
aaggacgaacaggaggaagaggaggcctttaaccagaagcatgcccttcagaaagccaaa
gaagtcagccccatgtctgccccaaacatgcctgctatcgaaagagacaggcggaggaga
caccacatgtcgatgtgggagccacgcagcagccacctgcgggagcgtcgccggcggcac
cacatgtcggtgtgggagcagcgcacgagccagctgcgccggcacatgcagatgtccagc
caggagggcatcaacaaggacgagccgcccctcatcaatccccacgccagcatcttccgc
aggaagagacccggggagggtgtcacgctggagaaatgcgcggaggagcaggccaaggcc
gagcgcgagggacccgagcagccggtcccaggggccaacccaggcggtggggaggacagg
acatcgccacgggccaagcgagacatgtggcagcagaagtcttgccacgggaactgtgag
ccaggagaacaggacggggcaggaggcagcattgaggacagggcgaggatgaggcagagc
cagcggcgcagccggcaccgcagagcccgcatggaggggaaggacacggctggcatcttg
gggagccgctcggccagccaggagatggggctggaggaggccagcaccgccgagggggca
caggacggggaccggactgcagcagaggcgctgattccaggggagccagaggcgagcggg
gattccatcaggacaaacggggtccctgctggcgatgccgatctgattgggaccgccaag
aaggggagccccccacacgccgcacccgagctctcccagggcaaggcgggcaacctgacg
gagcaggactgcagcagcccggacacgagcgagcaggcgctgctggagcccaggcgcagc
gtgagccgcagcgagcccgacctctcctccatcacccccaacaccgagaaggccaccgag
agcactgccatcatgatcgatgtccacgactccgctgtggtacagattagcaacaagaca
gacggtgaagccagccccttaaaggaggccgagaccaaagaggatgaggaagaaatggag
aagaagaagcggaagaaggaaaagagcgagacgggcaaagccatggtgccgcacagctcc
atgttcatcttcagcaccaccaacccggtgaggagggcctgccactacatcgtgaacctg
cgctacttcgagatgtgcatcctcctggtgatcgctgccagcagcatcgccctcgccgcc
gaggatcccgtcctcaccaactccgaccgcaacaaagtgctgaggtatttcgactacgtc
ttcactggtgtcttcaccttcgagatggtgatcaagatgattgatcagggcttgatcctg
caggatggctcctacttccgagacctctggaacatcctggatttcatcgtggtggtggga
gcgctggtggcttttgccttggcgaatgctttggggaccaacaaaggccgggatatcaag
accatcaagtctctccgtgtgctgcgggtcttgaggcccctgaaaaccatcaagagactg
ccaaagctgaaggctgtttttgactgtgtcgtgacgtctctcaagaacgtcttcaacatc
ctcattgtctacaagctcttcatgttcatcttcgccgtcatcgccgtgcagctcttcaag
gggaagttcttctactgcaccgacagctccaaggacacgcagaaggactgcatagggaac
tacgtggaccacgagaagaacaagatggaggtgaaatgccgggagtggaagcggcacgag
tttcactatgacaatatcatctgggctctgctcaccctgttcactgtgtccaccggtgaa
gggtggccccaggtgctgcagcactcggtggatgtgacggaggaggaccgtgggcccagc
cgcagcaaccgcatggagatgtccattttttatgtcgtctacttcgtggtcttccctttc
ttcttcgtcaacattttcgtggctctcatcatcatcacgttccaagagcaaggagacaaa
atgatggaggagtgcagcctggagaagaacgagagggcctgcattgacttcgccatcagc
gccaagcccctgacgcggtacatgccccagaacagacacaccttccagtaccgcgtgtgg
cacttcgtggtgtccccgtccttcgagtacaccatcatggccatgatagcactcaacacc
gtggtgctcatgatgaagtactattctgctccatacacctatgagctggccctcaagtac
ctgaacattgccttcaccatggtgttctccttggagtgcgtcctcaagatcatcgctttc
ggcttcctgaattatttccgggacacctggaacatctttgacttcatcacggtcatcggc
agcattacggagatcatcctgacggacaccaaggtgaagcagggctgggagcagtgggct
gtggggtggtggtgggagctcccacctccctctgatcctctcatctcctcccagctggtg
aacaccagcagcttcaacatgagcttcctgaagcttttccgggctgctcggctcatcaag
ctgctccgccagggttacaccatccgcatcctgctctggacctttgtgcagtccttcaag
gcactcccctatgtctgcctgctgattgccatgcttttcttcatctatgccatcattggg
atgcaggtttttggcaatatcaaactagatgaggaaagccacattaaccggcacaacaac
ttccgcagcttcctgggctccctcatgctcctcttcaggagtgccaccggagaggcgtgg
caggagatcatgctgtcctgcctggagggcaaaggctgcgagccggacacgacggccacg
tccgggcagaacgagaacgagcgctgcggcactgacctggcctacgtttactttgtgtcc
ttcatcttcttctgctccttcctgatgctcaacctgtttgtggctgtcatcatggacaac
tttgaatacctgacacgggattcctccatcctgggccctcatcatctggatgagtttgtc
cggatctgggcagagtatgaccgagcagcgtgcggcaggatctcgtataaggatatgtac
aaattagtacgggtgatctcgcctcctctgggcctaggagagaactgcccctacagggtg
gcgtgcaagagactggtgctgatgaacatgcccgtggccgaggacatgacagtccacttc
acctccaccctcatggccctgatccgcacggccttggacatcaaaattgccaaaggtggt
gcagactggcagcagttggactctgagcttcaaaaggagatcctgaccatttggcctcac
ctgtcccagaagatgcttgacctgttggtacccatgccaaaaacctctgacctgactgtt
gggaaaatatatgcagccatgatgatcatggattactacaagcagagcaaggcgaagaag
cagcggcagcagctggaggagcagaaaaatgcccccatgttccagcgcatggagccgtcc
tctctgccccaggaaatcatctccaatgccaaggctctgccgtacctccagcaggacacc
ctctcgggcctgagcagccgaggcgggttcccctcgctgagcccgctctcgccacaggag
atcttccagctggcgtgcatggatccggcccaggagcagttccaggagcaccagtctctg
gtggtgacggacaccagctccatgcggagatcgttctccaccatccgggacaagcggccc
aacagctcctggctggatgagttctccatggagcgcagcagcgacaacacctacaagtcc
cgccggcgcagctaccactcctcactccagctgtccgcccggcgcctcaacgctgactca
ggccaccggtccgaggggcaccgctcgggcagggagcggggccggtccaaagagcgcaag
cacctgctgtcccctgacatctcccgctgcaactccgaggagaggagtccccaggcacag
gaggagtcgccagagcggcggcgcgagtcccggtcacccagcgagggcaggtcacagaca
cccagcaggcagggcatgggctccctgagcgaaagctccatcccctccatctcggacacc
agcacgccccggcgaggccgccgccagctgccgccggtgccccccaagccgcgtcccctc
ctgtcctacgcctccatgctgcgacacgccggggacacctctcctcccgccgacgagagc
gagggcggctcgccgctgctctcctccagcctggatcccagcacggccggcccggccgag
tcttccagctccccggtggcggggaagcagagccggcagtccacgccgcagcgctacatc
tcggagccctacctggcgctgcacgacgactcgcacgcctcagactgcggtgaggaggag
acgctcaccttcgaggcggccgtggccaccagcctgggccgctccaacaccatcggctcg
gcgccgccgctgcggcacagctggcagatgcccaacgggcactaccggcggcggcggcga
ggagcggcgcagggcgtgatgtgcggggccagcatcgacgtgctcagcgacacggaggaa
gatgacaagtgctag

DBGET integrated database retrieval system