KEGG   Lonchura striata domestica (Bengalese finch): 110484490Help
Entry
110484490         CDS       T05897                                 

Gene name
KMT5B
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B isoform X1
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110484490 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lsr03036]
    110484490 (KMT5B)
Enzymes [BR:lsr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     110484490 (KMT5B)
Chromosome and associated proteins [BR:lsr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110484490 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF3970
Motif
Other DBs
NCBI-GeneID: 110484490
NCBI-ProteinID: XP_021410858
LinkDB All DBs
Position
Unknown
AA seq 854 aa AA seqDB search
MKWLGESKNMVVNGRRSGSKSSNDHAQTKLQHAGKENPKTGKNGVERRSSRCSGASGFEG
QSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEVIERFK
KDEHLEKAFKSLTSGDWARHYFLNKNKMQERLFKEHVFIYLRMFATDSGFEILPCNRYSS
EQNGAKIVATKEWKRNDKIELLVGCIAELSEMEENMLLRHGENDFSVMYSTRKNCAQLWL
GPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEYCECYTCE
RRGTGAFKSRVGLPAPTPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTT
QEKGNATNRKSSIGVKKNSKNRTLTRQSISRIPASSNSTSSKLTHINNSRVPKRLKKPAK
PLLSKIKLRNQCKRPEQKNASRKLEVGNLVLKEPKVVLYKNLPIKKDKELEGPVKVAVSS
GCLTRHAAREHKLNSVKGAYEHGGIAPCTYITRRSMRTRMSLKETSDTKLEPNTLDSYQS
NLTGTQSDIAEQQSRALNNSNVAHGPSHKGEGRCQKSDAGTSKKKSRQGKLVKPSSKTEE
NDTMHNTPVKDEVPDLISSHSELEERNNVVDTPVGFKDCVPGSGGCSVTTDNFKAKDSFR
TAKSKKKRRITRYDAQLILENSSGIPKLTLRRRHDSSSKANDQESDGMNSSKISIKLSKD
HEKDNNLYVAKLNNGFNSGSGNSSTKLKIQLKREDENRGAYPEDLHENGVCCSETLSLLE
SRMEVDDYGHYEEETADESSSEEDDEEEDDYDDEFDDFIPLPPAKRLRLIVGKDSIDIDI
SSRRREDQSLRLNA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctgggagaatccaagaacatggtagtgaatggccggagaagtggaagcaag
tcatctaatgaccacgcacagaccaaattgcagcatgcaggaaaggagaatccaaagacg
ggcaaaaatggagttgagagaagatcaagcagatgtagtggtgcttcaggatttgaggga
caaagtcgttatgtgccttcctctggaatgtctgccaaggaactctgtgaaaatgatgac
ctagcaactagtttggttcttgatccctatttaggttttcagacacacaaaatgaatact
agatttcgacctattaaaggaaggcaagaagaactcaaagaggtgattgaacgttttaag
aaagatgagcacttagaaaaagccttcaagtccttgacgtcaggtgactgggcccggcac
tattttcttaacaagaacaaaatgcaggaaaggttgttcaaggaacatgtatttatttat
ttacgaatgtttgcaactgacagtgggtttgagatactgccttgtaatcggtattcttct
gagcaaaatggagccaaaattgttgcaacaaaagaatggaaacgaaatgataaaatagaa
ttacttgtgggctgtattgctgaactatcagaaatggaagaaaacatgctgctgagacat
ggggaaaatgatttcagtgtcatgtattccacacgaaaaaactgtgcacaactatggctt
ggtcctgctgcatttatcaatcatgattgcagacctaactgtaagttcgtatcaacaggc
agagatacagcatgtgtgaaagctctaagagatattgaacctggagaagaaatctcttgt
tactacggagatgggttttttggagaaaataatgaatactgcgaatgttacacctgtgaa
agacgtggaactggtgcttttaaatcaagagtgggattgccagcacctactcctgtgatt
aacagtaaatatggactgagagaaacagacaaacgattgaacagacttaaaaagttgggt
gacagcagcaagaattcagatagccagtccgtcagttctaacactgatgcagataccact
caggaaaaaggtaatgcaactaacagaaaatcttcaattggtgtaaaaaagaacagcaaa
aatagaacattaaccagacagtctatatcaagaattccagcatcatcaaactctacctca
tctaaactaactcatataaataattccagggtaccaaagagactgaaaaagcctgcaaag
cctttactttcaaagataaagttgagaaatcagtgcaaaaggccagagcaaaagaatgct
tctcgaaagcttgaagtgggaaatttagttctcaaagagcctaaagtagttttgtataaa
aacttgcccattaaaaaggataaagaattggagggaccagtcaaagttgcagtctctagc
ggatgcttaacgaggcatgcagcaagagaacataaactgaattctgtgaaaggtgcttat
gagcatggtggtattgcaccctgcacatacatcacgaggaggtccatgagaacaaggatg
agtttgaaggagacctctgacacaaagcttgaaccaaatacattggatagctatcagagt
aacttgactggaacacaatcggacattgcagagcagcagtctcgtgcactaaacaacagc
aatgtggctcatggaccatcacataaaggagagggtcggtgccagaaaagtgatgcaggc
acatcaaaaaagaaatctcgacaaggaaagcttgtgaaaccatcttcaaagacagaggaa
aatgatactatgcacaacacgcctgtgaaggatgaagtaccagatctgattagttctcat
tcagaacttgaagagaggaataatgtggtggacacacctgttggctttaaagactgtgtc
cctggatctggtggctgctctgtaacaactgacaattttaaagcaaaagacagctttaga
actgcaaaaagtaaaaagaaaagacgaatcacgaggtatgatgcacaacttatccttgaa
aatagctctgggatccctaaactgactcttcgtaggcgccatgatagcagtagcaaggca
aatgatcaagagagcgatggaatgaattcttcaaaaataagcataaaattaagtaaagac
catgaaaaagataataatttatatgtagcaaagctaaataatgggtttaactcaggatca
ggcaatagttcaacaaaactaaaaatacagctaaaacgagaggacgaaaacagaggtgca
tatccggaggaccttcatgaaaatggtgtgtgttgtagtgaaactctctcccttttggag
tcaagaatggaagtagatgattatggtcactatgaagaggaaacagcagatgaatcttca
tcagaagaggatgatgaagaggaagatgactatgatgatgaatttgatgactttattcct
cttcctccagcgaagagattaaggcttattgttggcaaggattcaatagatattgatatt
tcttccaggaggagagaagatcagtctttaaggctcaatgcataa

DBGET integrated database retrieval system