KEGG   Leuconostoc mesenteroides subsp. suionicum: A6B45_05555Help
Entry
A6B45_05555       CDS       T05489                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
lsu  Leuconostoc mesenteroides subsp. suionicum
Pathway
lsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lsu01100  Metabolic pathways
lsu01110  Biosynthesis of secondary metabolites
lsu01130  Biosynthesis of antibiotics
lsu01230  Biosynthesis of amino acids
Module
lsu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:lsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A6B45_05555
Enzymes [BR:lsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     A6B45_05555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 NeuB
Motif
Other DBs
NCBI-ProteinID: API72168
UniProt: A0A2N9K7T8
LinkDB All DBs
Position
complement(1126561..1127553)
Genome map
AA seq 330 aa AA seqDB search
MIIIAKTSQDAEKIAAQLDTKNPIKPVFVHNNRVALAGVKKLPEDALKSISQYIVETITN
HHSAIKSSRDFHPENTIITTKYSVIGGANFVFMAGPDSIESPEHVKEMGEDVKQAGATIL
RGGAFKPRTSPYSFQGNGEEGLKAHRAAADALKMDMVTEILDTRDVDLVDSYTDIFQVGT
RNMQNFALLKALGKKNKPVVLKRGMSATIDDLLNAAEYIAAGGNDQIILMERGIRTYDNK
YTRNTLDVSAIPVLQSLTHYPVVADASHAAGVSKFVEPLALAAIAAGAQGLMTEIHDDPS
HAFVDGAQALTPAQFKQLTEKANKVREAIK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgattattatcgcaaaaacaagtcaagatgcagaaaaaattgcggcgcaattagatact
aaaaatcctattaaaccagtgtttgttcacaataatagggttgcgttagctggtgtaaag
aagttacccgaagatgcattgaaaagtatttcacaatacattgttgagacaatcacaaat
catcattcagccatcaagtcatcacgtgactttcatccagagaatacaattattacaact
aaatatagtgtcattggtggggccaactttgttttcatggccggccctgattcaatcgaa
tctccagaacatgtcaaagaaatgggtgaagatgttaagcaggcgggcgcaactatcttg
cgcggtggggctttcaaaccacgtacatcaccatattcatttcaaggtaacggcgaagaa
ggtttaaaagcccatcgtgcagcagcagatgcgttgaaaatggacatggtaaccgaaata
ttggatacacgagatgttgatttggttgattcttacacagatattttccaagttggtacg
cgtaatatgcaaaacttcgctttgcttaaggctctggggaagaagaacaaaccagtggtt
ttgaaacgtgggatgtcagcaaccattgatgatttgcttaatgctgctgaatacattgct
gctggtggcaatgatcagattattttgatggaacgcggtattcgtacttatgataataag
tacacgcgtaatacgcttgatgtatcggccattcctgttttacaatcattgacacactat
cctgttgtcgcagatgcttcgcatgctgccggtgtttcaaagtttgttgagccgcttgct
ttggctgcaattgctgctggtgcacaaggtttgatgaccgaaatacatgatgatccatca
catgcctttgttgatggggcacaagcattgacaccagcacaattcaaacaattgacagag
aaagcaaacaaggtgcgcgaggcgataaaatga

DBGET integrated database retrieval system