KEGG   Leuconostoc mesenteroides subsp. suionicum: A6B45_07355Help
Entry
A6B45_07355       CDS       T05489                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
lsu  Leuconostoc mesenteroides subsp. suionicum
Pathway
lsu00340  Histidine metabolism
lsu01100  Metabolic pathways
lsu01110  Biosynthesis of secondary metabolites
lsu01230  Biosynthesis of amino acids
Module
lsu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    A6B45_07355
Enzymes [BR:lsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     A6B45_07355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: API72501
UniProt: A0A2N9K707
LinkDB All DBs
Position
complement(1501001..1501345)
Genome map
AA seq 114 aa AA seqDB search
MPQQTIEELYEQALDRKQNPQTGSYTDYLYQKGLDKILKKVGEESTEVILGAKNNNEELI
YETSDLLFHLMVLLVEKGVSLDDIKDELGSRLGKKSLLHERADWRGDKKNEKDS
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgccacaacaaacaattgaagaactttatgaacaagcacttgatcgcaaacaaaatccc
caaacaggatcctatactgattatctatatcaaaaaggattagataaaatcctaaaaaaa
gtaggagaagaaagcacggaagtaattctcggcgccaaaaataataatgaagagttaatt
tatgaaacttcagatttattgtttcatttaatggtcttattagttgaaaagggtgtcagt
ttagatgatattaaagatgaattagggtcacgtttaggaaaaaaatcattattgcatgaa
cgagctgattggcgaggagacaagaaaaatgaaaaagacagttaa

DBGET integrated database retrieval system