KEGG   Lactuca sativa (garden lettuce): 111879167Help
Entry
111879167         CDS       T05352                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111879167
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lsv03036]
    111879167
Enzymes [BR:lsv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     111879167
Chromosome and associated proteins [BR:lsv03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111879167
   Polycomb group proteins
    PRC2-EZH2 complex
     111879167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 111879167
NCBI-ProteinID: XP_023731408
LinkDB All DBs
Position
Unknown
AA seq 909 aa AA seqDB search
MSSPAVPLPSYTAAGRSESPDVSTIVGPQGAAIAPEEISLVIESFKKKVDADRCVYIMKR
MEENRIKLAEVTNNHYKLSVERRNLKTSVADQTVDLLTKRQKDAIDMQNGVNANNDDSDS
SSSQEDGHASAILLGSSIAVKNAVRPIKLPEVDKLPPYTTWIFLDRNQRMTEDQSVLGRR
RIYYDQNGGEALICSDSEEEAIDEEEEKKEFVESEDYIIRMTIQQLGSSDAVLDLLGQRL
SRKPSELKARYEVLVNRENAVEVSKPGNVEFDMSSLFDKDLEAALDSFDNLFCRRCLIFD
CKLHGCSQDLIFPVEKHCARVEEEKVPCGPHCYRQVQKTEGISVTSPTQLNSEQKATPKS
SDGNGVHKSRKKSKTLSVLQKLKSSRSENTSSNTKNMTESSESETRPTVHDGHSSKRGTR
QRNSKRIADHVMVAIKKRQKKPTASDSDSISVPSGSLGSHKENEEASSSSLKVKSLSGRR
GRRKDSFAPAAGGDRSSFQAEASDCPSKEITSKHNEKWKKEEFVDESVMCRQEVEQIEFK
SWKTIEKSLFEKGLEIFGRNSCLIARNLMNNMKTCSEVFYAMNSSENKLSSQGGDGTSSL
GDGSRIDSNENMGTTLRRRSRFLRRRGRVRRLKYSWKSAGYHSMRKRISDKKELPCRQYN
PCGCQTSCGKECSCLVSGTCCEKYCGCPKTCKNRFRGCHCAKSQCRSRQCPCFAAGRECD
PDVCRNCWIGCGDGTLGIPGQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVP
KHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQYVLDAYRKGDKLKFANHSPVP
NCYAKVIMVAGDHRVGIFAKERISGGEELFYDYRYEPDRAPAWAKKPESSSATKKEETGP
SSGRAKKLA
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgccggcggtccctcttccatcgtatacagccgccggtcgatcggagtctcca
gatgtatctacgattgtgggaccacaaggagcagctattgctcctgaagaaatttcactg
gttatcgaatctttcaagaagaaagttgatgctgatcgttgtgtttatatcatgaaaaga
atggaagagaacaggattaagttggctgaagtcaccaacaaccattacaagctgtcagta
gaaagaagaaacctaaagactagtgttgcagatcaaactgttgatttattaacaaagaga
caaaaagatgccattgatatgcaaaatggtgtgaatgcaaacaatgatgatagtgacagc
agcagctctcaagaagatggacatgcttcagccattcttttaggatctagcattgcagta
aaaaatgctgtcagacctatcaagcttcctgaagtggataaattacctccttataccact
tggattttcttggatagaaatcaaagaatgacagaagaccagtctgtattgggtcgaagg
agaatctattatgatcaaaatggtggtgaagctttgatttgtagtgatagtgaagaggaa
gcaattgatgaagaagaggaaaagaaagagtttgttgagtctgaagattacatcatcaga
atgaccattcaacaacttggctcatctgatgctgttttggatttactaggacaacggttg
tccagaaaaccttctgaactcaaggcaagatatgaagtccttgtgaatagagagaatgct
gttgaagtctccaaaccaggaaatgtggagtttgatatgagttcattgtttgataaagat
cttgaagcagcattagactcatttgacaacctattttgtcgcagatgtcttatatttgac
tgtaaattacatggatgctcacaggaccttatatttcctgttgaaaagcattgtgcccgt
gtggaagaagagaaggtgccttgtggtccccactgttatcgccaggtccaaaagacggag
ggcatttcagtcacatcacctacacagctcaacagcgaacaaaaagccactccaaaatct
tcagatggcaacggtgttcataaatcaagaaaaaagtccaaaactttgtctgtattacag
aagttaaaatcttccaggagtgaaaacacttcatcaaacactaaaaacatgactgaaagc
agcgaatcagaaaccagacccactgttcatgatgggcattctagtaaacgtgggacccgc
caaaggaatagcaaacgcattgctgatcatgttatggttgcaataaagaaaagacagaaa
aagcccactgcttccgattccgattccatttctgttcccagtggaagcctcggctcacat
aaagaaaatgaggaagccagctcctcgtctttgaaggtgaagtctttgagtgggagacgg
ggtaggcgaaaagactcatttgcccctgctgctggtggtgataggtcgtcttttcaggcg
gaagcttctgattgcccttccaaggagatcaccagtaaacacaatgagaaatggaagaaa
gaagagtttgtggatgagagtgttatgtgtagacaagaagtagaacagattgaattcaaa
agctggaaaacaattgaaaagtctctttttgaaaaagggctggagatttttggcagaaac
agctgtttaatagctaggaatctaatgaacaacatgaagacatgttcagaggtattctac
gccatgaattcctcagaaaacaagctatcttctcaagggggcgatggcacatcttctcta
ggagatggatccagaatcgattctaacgaaaacatgggtacgacgctaagaagaagatca
cgattcttacgcagaagaggaagagttcgtcgtttaaaatattcatggaaatctgctgga
taccattcaatgaggaaaagaatctctgataaaaaagaactcccttgtcgccaatataac
ccatgtggttgtcaaacttcatgtgggaaagaatgctcttgccttgtcagcgggacttgc
tgtgaaaaatactgcggatgtccgaaaacatgcaaaaatcgttttagaggatgccattgt
gcgaaaagtcaatgtagaagtcgtcaatgcccttgctttgctgcgggtcgagaatgtgat
ccggatgtgtgcagaaactgctggatcgggtgtggcgatgggactttagggattccgggg
caaagaggtgataattatgaatgtagaaatatgaagcttcttctcaaacaacaacagcgg
gttttattaggaaggtctgatgtctcaggctggggagcctttttaaagaatagtgtacct
aaacatgaatatctgggtgagtacactggagaattgatctcacatcgtgaagctgacaaa
cgtggaaagatttacgatcgtgaaaattcatccttcctttttaacctcaatgaccagtac
gttcttgatgcttatcgaaagggcgataaactgaagttcgctaatcattcccctgttcca
aattgttacgcaaaggtgataatggtggcgggagatcatagagttggaatattcgctaaa
gaaagaataagtggtggggaagaactgttttatgattaccgatacgaaccggatagggca
cctgcttgggccaaaaaaccagagtcatcatccgctacaaaaaaagaggaaaccggtcct
tctagtgggcgtgcaaagaagcttgcttga

DBGET integrated database retrieval system