KEGG   Lactuca sativa (garden lettuce): 111886023Help
Entry
111886023         CDS       T05352                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv03030  DNA replication
lsv03410  Base excision repair
lsv03420  Nucleotide excision repair
lsv03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111886023
   03410 Base excision repair
    111886023
   03420 Nucleotide excision repair
    111886023
   03430 Mismatch repair
    111886023
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lsv03032]
    111886023
   03400 DNA repair and recombination proteins [BR:lsv03400]
    111886023
Enzymes [BR:lsv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111886023
    6.5.1.6  DNA ligase (ATP or NAD+)
     111886023
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111886023
DNA replication proteins [BR:lsv03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111886023
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111886023
DNA repair and recombination proteins [BR:lsv03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111886023
   NER (nucleotide excision repair)
    Other NER factors
     111886023
   MMR (mismatch excision repair)
    Other MMR factors
     111886023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase Presenilin
Motif
Other DBs
NCBI-GeneID: 111886023
NCBI-ProteinID: XP_023738030
LinkDB All DBs
Position
Unknown
AA seq 844 aa AA seqDB search
MLSLRSCCYSVTHTNTITTAFSHPIRHSLLKLSSSSSLTFPLFFLSNKMSSSRPSAFDAL
MSNARAAAAKKKTTESSASPKKRKTLDSKPPISSTPISEAKVAEASPKPDKPLDTNTKKK
TQVSSSSPKKRKTLDSKPPINSTPVTEAKVAEVSPKPEKTSDTNQSKDETVSNEIIEAKP
NLDVAPSKEENASKKPRPIDVDESMIQLKKKPANFKPEKAAFWGEGERVPFLFLCRVFDA
ISKESGRILITEIVCNMLRTVIKTTPDDLVGVVYLLANRIAPAHEGLELGIGDASIIKAL
AEACGAKEAHIKKQYKELGDLGLVAKASRSSQPLMRKPQPLTVSKVFDTFRVIAKESGKD
SQDKKKNHIKGLLVAATDCEPQYLIRLLQTKLRIGLAEQTLLTALGYAIVYTENGESPSK
HSDSPLEEAAKIVKQVYSVIPVYDKIVPALLSDTVWNLPKTCCFSPGVPVGPMLAKPTKG
VSEILDKFQDMEFTCEYKYDGERAQIHYLEDGTVQIYSRNAERNTEKFPDVVVAASRVKK
PSVTSFVLDCEIVAYDRKKQKILPFQILSTRARKNVVMSDIKVDVCIYAFDLLYLNGQQL
LQEQLSVRRERLYESFNEEPGFFQLATAITSNDLEKIQTFLDAAVNGSCEGLIIKTLNKD
ATYEPAKRSNNWLKLKKDYMDSIGDSLDLVPIAAFHGRGKRVGVYGAFLLACYDNNKDEY
QTICKIGTGFSEAMLEERSTSLRSKVIPKPKSYYRYADSINPDVWFEATEVWEVKAADLT
ISPVYCAAIGAVDPNKGISLRFPRLLRVREDKGPEDASSSDMVADMYNAQKHTQGNNQDD
NDDE
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgttatcgctccggtcatgttgttatagtgtgactcacaccaacaccataaccaccgca
ttctctcaccctattagacattctcttcttaaattgtcgtcgtcatcatccctaacattt
cctctcttctttctttcgaacaaaatgtcatcatctcgtccctccgccttcgatgcactc
atgtccaatgctcgtgcggctgccgcgaagaagaaaaccacggaatcttccgcttcccct
aagaaacgcaaaaccctagattcaaaacccccaattagttcgacacctattagcgaagct
aaagttgcagaagcctcaccaaagccggataaaccattggatacgaacacaaagaagaaa
acccaggtgtcttcctcgtcccccaagaaacgcaaaaccctagattcaaaacccccaatt
aattcgaccccagtcaccgaagctaaagttgcagaagtctcaccaaaacccgagaaaaca
tcggacacgaatcaaagtaaagacgaaactgtctcaaatgagattatagaagctaagcca
aaccttgatgttgctccatcaaaggaagaaaatgcatctaaaaaaccacggccgattgat
gttgatgagagtatgattcaattgaagaagaaaccggcaaacttcaaacccgaaaaggct
gcgttctggggcgaaggagaaagggtgccgttcctatttctctgtcgggtttttgacgca
atctccaaagaatctggtcggattctgattacagaaatcgtctgtaacatgctgagaact
gtaatcaagacaacacctgacgatttagttggggttgtatacctcttggctaatagaatc
gccccagctcacgaaggattagagcttggaatcggtgatgcttccatcatcaaagctctc
gctgaagcttgtggtgcaaaagaagcacacatcaaaaagcaatacaaggaactgggagac
ttgggccttgttgccaaagcaagccgctcttcccaacctctgatgcgtaaacctcaacct
ttgacagtttcgaaagtttttgatacattcagggttattgccaaggaatctgggaaggat
agtcaagataagaagaagaatcatatcaagggacttcttgttgcagcaactgactgtgaa
cctcaatatttgatacgtttacttcagacaaaattgcgaattggtttagctgaacaaaca
ctcttaactgcattggggtatgctattgtgtatactgaaaatggtgaatcaccttcaaag
cactcagattcaccattagaagaggctgcaaagattgtgaaacaagtgtactctgtaatt
cctgtatatgacaaaattgtccctgctcttctctctgatactgtatggaatctaccaaaa
acatgttgcttttcacctggtgttccagtgggacccatgcttgctaaacctactaaagga
gtatctgaaattttggataaatttcaagatatggagttcacttgtgaatacaaatatgat
ggagaacgggcccagatacattatttggaagatggcacagttcaaatatacagcagaaat
gctgaaagaaatactgaaaagtttcctgatgttgtggttgctgcttcaagagttaaaaaa
ccaagtgtgacatcatttgttttggactgtgaaatcgttgcatatgatcgcaagaaacaa
aaaattctcccattccagattttaagcacacgtgctcgaaaaaacgttgtaatgagtgac
atcaaagtggatgtatgcatttacgcatttgatttgttgtatttgaatggacaacaactt
ttacaagaacaacttagtgttcgtagagagcgtctatatgaatccttcaatgaagaacct
ggatttttccagcttgcaacagccataacttcaaatgatctggaaaaaattcaaaccttt
ttagatgctgctgtcaatggcagttgtgagggtttgattatcaaaacgttaaataaagat
gcgacatatgagcctgcaaagcgatcaaataactggctcaagttaaagaaagactatatg
gacagtattggtgactcattggatttagtgccaattgctgcttttcatggaagaggaaaa
cgtgtaggtgtatatggtgcttttcttcttgcttgttatgacaacaataaggatgaatat
caaactatttgcaaaattgggactggtttttcagaagccatgcttgaagaaaggtctaca
agtcttcgttctaaagtcatcccaaaacccaagtcatactaccgatatgcagattctata
aatccagatgtgtggtttgaggcaactgaggtttgggaggtcaaagctgcagatttgacc
atcagccctgtttattgtgctgcaattggtgcagttgaccctaataagggtatttcactg
agattcccacgtttacttcgtgttagagaagacaagggtccggaggatgcttcatcttca
gatatggttgctgatatgtataatgctcagaaacatacacaaggtaacaatcaagatgat
aacgatgatgagtga

DBGET integrated database retrieval system