KEGG   Lactuca sativa (garden lettuce): 111888746Help
Entry
111888746         CDS       T05352                                 

Definition
(RefSeq) hexokinase-2, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00010  Glycolysis / Gluconeogenesis
lsv00051  Fructose and mannose metabolism
lsv00052  Galactose metabolism
lsv00500  Starch and sucrose metabolism
lsv00520  Amino sugar and nucleotide sugar metabolism
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
lsv01200  Carbon metabolism
Module
lsv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lsv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111888746
   00051 Fructose and mannose metabolism
    111888746
   00052 Galactose metabolism
    111888746
   00500 Starch and sucrose metabolism
    111888746
   00520 Amino sugar and nucleotide sugar metabolism
    111888746
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    111888746
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lsv04131]
    111888746
Enzymes [BR:lsv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     111888746
Membrane trafficking [BR:lsv04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    111888746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Sir1
Motif
Other DBs
NCBI-GeneID: 111888746
NCBI-ProteinID: XP_023740628
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MSFAVNSPPAVRHFPLSRSSVCRTPRVTMVARSTTGVSVSTAAALPILTKLQNDCSTPLP
VLRHVADAMATDMRAGLAVDGGSDLKMILSYVDSLPTGNERGLFYALDLGGTNFRVLRTQ
LGGKEERVIDTEFEQVSIPQDIMFGTSEELFDFIASALANFVKKEGGKFVLQKDRSRETG
FTFSFPVKQTSIDSGILMKWTKGFAVSGTPGKDIVVCLNEAMGRQGLNMRVSALVNDTVA
TLAGARYWDDDVMVAVILGTGTNACYVESVNAIPKLQGHKSISGKTIVNTEWGAFSNGLP
LTEFDREMDAESINPGEQLFEKTISGMYLGEIVRRVLVRMAEESSLFGKDIPKRLRTPFT
LGTPNISSMQQDTSDDLEAVGSILYEVTGMDSNLDSRKMVVEVCDTIAKRGGRLAGAGIV
GILQKMEEDSKGIVFGKRTVVAMDGGLYEHHPQYKRYLKDAVKELLGPEISSNVVIEHSK
DGSGIGAALLAATNSIYEH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgccgtcaactcaccgccggccgtcagacacttccccctttcccggtcatcc
gtttgccgcacaccacgtgtcaccatggtcgcccgatccaccaccggtgtctcagtctcc
accgccgctgcactccctatattaaccaaattacaaaacgactgttccacccctctcccc
gtcctccgccacgtcgctgacgccatggcaactgatatgcgagccggcctcgccgtggat
ggcggcagtgatctcaagatgatccttagttatgtcgattctttgccaactgggaatgag
agagggttgttctatgcattggatcttggtggaacaaattttcgagttcttagaactcaa
ttaggaggaaaggaagaacgagtgatagacacggaattcgagcaagtttcaataccacaa
gatatcatgtttggcacctccgaggagctgtttgattttattgcctctgctttagcaaat
tttgtgaaaaaagaggggggaaagtttgtgttgcaaaaagacagaagtcgagaaacgggg
tttactttctcttttccggtgaaacaaacctccattgattccgggatactaatgaaatgg
actaaaggttttgcagtctcgggaacgcccggaaaagatatcgttgtgtgtttaaatgaa
gctatgggaaggcaagggctgaatatgcgggtatccgcactggttaatgatacggtagca
acactagccggggcaagatactgggatgatgatgtcatggttgcggttattctcgggaca
ggaacaaatgcttgctatgtagaatccgtgaatgccattcctaaactacaaggccataaa
tctatctcgggaaaaacgatagtgaatacagagtggggagcgttctcaaacggtcttcct
ttgactgaattcgatagagagatggatgcggagagtataaaccccggtgagcagttattt
gaaaagacgatatcgggtatgtatcttggcgaaattgtgagacgggtacttgtgaggatg
gctgaagaaagttcgttatttggaaaggatattcctaaaagactacgaactcctttcact
ctcgggaccccaaatataagttctatgcagcaggacacttctgatgatcttgaagctgtg
ggatcgatcctttatgaagtaacagggatggattcaaatttagattcgaggaagatggtg
gtggaggtttgtgacacgattgcaaagcgtggtggccgattggcgggagcaggaattgtt
gggatactacaaaagatggaggaggattcaaagggtattgtgtttggaaaacgtacagtt
gttgccatggatggaggcctatatgaacaccaccctcaatacaagagataccttaaagat
gctgtaaaagagcttttagggccggagatatcaagcaatgtagttattgagcattcgaaa
gacggatctggtattggagctgcactcttagcggctacaaactcgatttacgaacattaa

DBGET integrated database retrieval system