KEGG   Lactuca sativa (garden lettuce): 111891660Help
Entry
111891660         CDS       T05352                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00010  Glycolysis / Gluconeogenesis
lsv00053  Ascorbate and aldarate metabolism
lsv00071  Fatty acid degradation
lsv00280  Valine, leucine and isoleucine degradation
lsv00310  Lysine degradation
lsv00330  Arginine and proline metabolism
lsv00340  Histidine metabolism
lsv00380  Tryptophan metabolism
lsv00410  beta-Alanine metabolism
lsv00561  Glycerolipid metabolism
lsv00620  Pyruvate metabolism
lsv00903  Limonene and pinene degradation
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111891660
   00053 Ascorbate and aldarate metabolism
    111891660
   00620 Pyruvate metabolism
    111891660
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111891660
   00561 Glycerolipid metabolism
    111891660
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111891660
   00310 Lysine degradation
    111891660
   00330 Arginine and proline metabolism
    111891660
   00340 Histidine metabolism
    111891660
   00380 Tryptophan metabolism
    111891660
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111891660
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    111891660
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111891660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 111891660
NCBI-ProteinID: XP_023743487
LinkDB All DBs
Position
Unknown
AA seq 538 aa AA seqDB search
MAARRLSGVLSRSLSLRPLSSSIVSRGKRSNLEGELRRFGTAAAFEQPITPSVRINYTQL
LIDGKFVDSASGKTFPTLDPRTGEVIANVAEGDAEDINRAVSAARKAFDEGPWPKMSAYE
RSCVLLRFADLVEKHNDEIAALETWDNGKPYEQAAKAEVPMLTRLFRYYAGWADKIHGLT
VPADGPYQVHTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLTALY
VAQLLHEAGLPPGVLNIVSGFGPTAGAALASHMDVDKIAFTGSTETGKIVQELAAKSNLK
PCTLELGGKSPFIICEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKSR
ARAQRRTVGDPFQKGIEQGPQIDSEQFEKILKYIKSGVESNATLECGGDRLGSKGFYIQP
TVFSNVQDDMLIAKDEIFGPVQSILKFKEIDDVIKRANATRYGLAAGVFTKNLDTANRLT
RALRAGTIWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTALKNPAWL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcgaagactctccggcgtcctctcccggtcactttctcttcgccctctttct
tcttcgattgtttctcgaggaaaaagatccaacttggaaggcgaattacgaagattcggt
actgctgcagcatttgaacaaccaattactccatctgttcgcattaattacactcagctt
ctaatcgatggaaaatttgttgattcagcatctggaaagacattcccaaccttggatcca
cgaacaggggaagtcattgccaatgtagcagaaggcgatgcagaagatatcaatcgggca
gtttctgctgcccgcaaggcgttcgacgaagggccttggcctaaaatgagtgcttatgaa
aggtcgtgtgtcttgctaagattcgcggatttggtggaaaaacacaatgatgaaattgca
gcccttgagacatgggacaacgggaagccatatgaacaggctgcaaaagctgaagtacca
atgttgacgcgtctatttcgctattatgctggttgggcggataagatccatgggttaacg
gttccagcagacgggccttaccaagtgcatactttgcatgaaccaattggggttgctgga
cagatcattccatggaactttcctcttcttatgtttgcttggaaagtcggtcctgccctt
gcttgtggcaacaccattgttctaaaaacagctgaacaaactccattgactgctctttat
gttgcacaattgctccatgaggcgggtcttcctccaggtgttcttaatatagtttcagga
tttggtccaactgcaggagcagctcttgctagccatatggatgttgataagattgctttt
acaggatcgactgaaaccggtaaaattgtgcaagaattggctgcaaaaagcaatcttaag
ccatgtactttagagcttggagggaaatcgccttttattatttgtgaggatgctgatatt
gataaggctgtggagctagctcactttgctctctttttcaatcaaggacaatgttgttgt
gctggttcgcgtacatttgttcatgagcgcgtatacgatgagtttatagagaaatcaaga
gcacgtgctcaaagacgcactgttggtgatcctttccaaaagggtattgaacaaggtcct
cagatcgactcggagcaatttgagaagatcttaaaatacataaaatccggtgttgaaagc
aatgcgacgcttgaatgtggaggtgacagattagggtccaaaggtttctacatccaacca
accgttttctctaatgttcaggacgatatgctgatagcaaaagatgagatcttcggccct
gttcaatccatcttgaaattcaaggagatcgatgatgtgataaagagggctaatgcgaca
agatatggacttgcagctggtgtgttcaccaaaaaccttgatacagcaaacagattgact
cgggcattgagggctgggactatttgggtgaattgttttgatgtgtttgatgctgcaatt
cctttcggagggtataagatgagtggaattggaagggagaagggtatttacagccttaat
aattatttacaggtgaaggctgttgttactgcattgaaaaatccagcttggttgtga

DBGET integrated database retrieval system