KEGG   Lactuca sativa (garden lettuce): 111893802Help
Entry
111893802         CDS       T05352                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00250  Alanine, aspartate and glutamate metabolism
lsv00410  beta-Alanine metabolism
lsv00430  Taurine and hypotaurine metabolism
lsv00650  Butanoate metabolism
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
Module
lsv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111893802
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111893802
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111893802
   00430 Taurine and hypotaurine metabolism
    111893802
Enzymes [BR:lsv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     111893802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 111893802
NCBI-ProteinID: XP_023745654
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MVISTTIADSDQNLHSTFASRYVRTSLPRFKLPDQSIPKDAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMSSLNKNYVDMDEYPVTTELQNRCVNIIAHLFHAPIGEDDAAVG
VGTVGSSEAIMLAGLAFKRKWQAKRKSQGKSCENPNIVTGSNVQVCWEKFARYFEVELKE
VKLKEGYYVMDPEKAVEMVDENTICVATILGSTMNGEFEDVKLLNNLLMKKNEETKWETP
IHVDAASGGFVAPFLYPNLEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRTKDDLPDEL
VFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKDIMTNCHENTMVLKEGLEK
MGKFNIISKDIGVPLLAFSLKDSSKYTVFNISESLRRFGWIVPAYTMPPDAQHISVLRVV
IREDFSHSLADRLIADIIKVVHELEGARFTADTSGARDGGTVEHVEHGLRPMERGIAKYL
RRFIHGKKTSSVC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcagcactacaatcgccgactccgatcagaacctccactccactttcgcttcc
agatatgtccgtacatctcttccaaggtttaagttgcctgatcaatctataccaaaggat
gcagcatatcaaataataaacgatgagttgatgctcgatggaaacccgagattaaacctg
gcgtcatttgtgaccacgtggatggagccagagtgcgataaacttatcatgtcatccctc
aataaaaactatgttgacatggatgagtaccctgtcactactgaacttcagaatcgatgt
gtgaacataatagcgcatctcttccatgctcccattggagaagacgatgctgctgttggt
gtaggaaccgttggatcatcagaggcgataatgcttgcaggtcttgctttcaaaagaaag
tggcaagctaagcggaaatcacaaggaaagagttgcgagaatccgaacattgtcactgga
tctaatgtgcaggtctgttgggagaaattcgcgaggtacttcgaggtggaattgaaagag
gtgaaattgaaagaagggtattacgtgatggaccctgaaaaagctgtagaaatggtggat
gaaaacacgatctgtgttgctacaattctcggatccaccatgaacggagagtttgaagac
gtgaagcttctgaacaaccttctaatgaagaaaaacgaagaaaccaaatgggaaaccccg
attcacgttgatgcagcgagtggagggtttgttgctccttttctttaccctaatcttgaa
tgggattttagattgccacttgtgaagagtattaatgttagtggacataagtatgggctc
gtgtatgctggtgttggttgggttgtgtggaggacgaaagatgatttgccggatgagctt
gtgtttcatataaactatttgggatcggatcagccgacctttactctcaatttctccaaa
gggtcaagccaaataattgcacaatactaccaatttattcgtcttgggtttgagggttac
aaggatatcatgacaaattgtcacgaaaacacaatggtactcaaagaagggttagaaaag
atgggaaagtttaatataatatccaaagacatcggggtcccattactagctttttctctt
aaagacagttcaaagtacaccgtgtttaatatatccgagtctctaagacgatttggatgg
attgttcccgcttacaccatgccaccagacgcacaacatatttctgttcttcgagtcgtg
attcgtgaggactttagccatagcctagcggatagactcattgcagatattatcaaagtg
gttcacgagcttgaaggtgcacgattcacggctgacacgagtggtgcacgcgatggtggg
accgttgaacatgttgaacatggcttgaggcctatggaacgaggaatagccaagtatttg
aggaggttcattcatggcaagaaaacaagtagtgtttgttag

DBGET integrated database retrieval system