KEGG   Lactuca sativa (garden lettuce): 111898179Help
Entry
111898179         CDS       T05352                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00010  Glycolysis / Gluconeogenesis
lsv00020  Citrate cycle (TCA cycle)
lsv00620  Pyruvate metabolism
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
lsv01200  Carbon metabolism
Module
lsv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111898179
   00020 Citrate cycle (TCA cycle)
    111898179
   00620 Pyruvate metabolism
    111898179
Enzymes [BR:lsv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     111898179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 111898179
NCBI-ProteinID: XP_023749867
LinkDB All DBs
Position
Unknown
AA seq 468 aa AA seqDB search
MMAQLLNSSFTPTTRGLRRQSIPSISQSTSRKSQIHAKIREIFMPALSSTMTEGKIVSWV
KSEGDKLNKGESVVVVESDKADMDVETFYDGYLAAIMVEEGGVAAVGSAIALLAETEDEI
AQAISKAKEQSSSSSSSSPAAPSPPPAETTIPDSLAVATVVKAAPVKAVASTHPASDGGK
RIVASPYAKKLAKELNVDLSGVVGTGPMGRIVAKDVEAAVVASVAVPVAAAAESAKPIAA
APGVELGSVVPFTTMQGAVSRNMVESLGVPTFRVGYTITTDALDALYKKIKPKGVTMTAL
LAKATALALAKHPVVNSSCRDGKSFTYNSNINIAVAVAIDGGLITPVLQNADKVDIYSLS
RKWKELVDKARAKQLQPQEYSTGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASEPTVV
ATKDGRIGMKSQMQVNVTADHRVIYGADLAQFLQTLAKIIEDPKDLTF
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgatggctcaactcctcaactcctctttcactcccaccactcgcggcctccgccgtcaa
tccataccttcaatctcacaatccacctcccggaaatcccaaatccatgccaagatccga
gagatcttcatgcccgcattgagctccaccatgactgaaggaaagatcgtctcatgggtc
aaatccgaaggcgacaagctcaataaaggcgagtctgttgtcgttgtagaatccgataaa
gccgatatggatgtcgagacattctacgatggctacttggctgccatcatggttgaagaa
ggcggtgtcgccgccgtcggctccgctatcgccctccttgccgaaaccgaagacgaaatc
gcccaagctatttccaaagccaaagaacaatcctcttcctcttcctcttcctcacctgct
gctccttcccctcctccagcggaaacgacaatacctgattctctcgccgtcgcaactgta
gtgaaggcggcaccggtgaaggccgtggcttcgacacacccggcttccgatggaggcaag
aggattgtagcgtctccctatgcgaaaaagcttgcgaaggaattgaatgttgatttgagt
ggcgtggttggtaccggaccgatgggcaggattgtggccaaggatgtagaggctgccgtt
gttgcttctgttgctgttcccgttgctgccgcggctgagtcagctaagccgattgctgca
gctccaggggtcgaattgggttctgttgttccatttactacaatgcagggtgctgtcagt
aggaacatggttgagagtcttggagttcctaccttcagagtgggatatacaatcacaact
gatgctcttgacgctctctacaaaaagatcaaaccgaagggagtgaccatgacagcatta
ttagccaaagctacagcgcttgcattggctaaacaccctgttgtgaattcaagttgtaga
gatggaaagagctttacatacaacagcaatatcaacattgctgttgcagttgcaattgat
ggtggattgattactcccgtgcttcagaatgctgataaggttgatatatattcattatca
agaaagtggaaagaattagtggacaaggccagggcaaaacagttgcaacctcaagagtac
agcacaggtacatttactctttccaaccttggaatgtttggagtggatcgctttgatgcc
atcttgccaccaggaactggtgcaatcatggctgttggggcatctgagcccactgttgtt
gccaccaaggatggtcgaatcggcatgaagagccagatgcaggtaaatgttacagcggat
catcgtgtaatatatggggcggatcttgcacagttcttgcagacactagcaaagatcatt
gaagatcctaaagatttaacattctag

DBGET integrated database retrieval system