KEGG   Lactuca sativa (garden lettuce): 111899019Help
Entry
111899019         CDS       T05352                                 

Definition
(RefSeq) uncharacterized protein LOC111899019
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00061  Fatty acid biosynthesis
lsv00780  Biotin metabolism
lsv01100  Metabolic pathways
lsv01212  Fatty acid metabolism
Module
lsv_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111899019
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    111899019
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lsv01004]
    111899019
Enzymes [BR:lsv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     111899019
Lipid biosynthesis proteins [BR:lsv01004]
 Fatty acid synthase
  Component type
   111899019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 111899019
NCBI-ProteinID: XP_023750668
LinkDB All DBs
Position
Unknown
AA seq 231 aa AA seqDB search
MASSALAHSLISPLNSHSPISIRTPKTLSVSSFNGFSIPRISRSPLVSNQLKTTHTSLIA
NCASTASDSSKDETPIELRFPAFPTVVDINQIREILPHRFPFLLVDRVIEYNPGVSAVGI
KNVTINDNFFPGHFPDRPIMPGVLMVEAMAQVGGLVMLQPEVGGSRDSFFFAGIDKVRFR
KPVVAGDTLVMRMTLTKLQKRFGIAKMDGKAYVGGEVVCEGEFLMAMGSSE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcagctcttgctcattcactcatctctccactcaattctcattccccgatc
tctatccgaacccctaaaaccctctctgtatcttccttcaatgggttttctatcccaagg
atctccagatcccctcttgtatctaaccaattgaagacaacccacaccagtttaatcgct
aactgtgcttcaactgctagtgatagctcaaaagatgaaaccccaattgaactcaggttc
cctgcatttcctactgttgttgatatcaatcagattcgtgagattttgccacaccgattt
ccatttcttttggtggacagggtgattgagtacaatccaggagtttcagcagttggcatc
aagaatgtgaccatcaatgacaactttttccctggccattttcctgatagaccaattatg
cctggtgttcttatggttgaggcaatggcacaagttggtggtttggtaatgttgcaaccg
gaagtgggcggctcacgtgacagtttcttcttcgccggaattgacaaggtgaggttcaga
aaaccggtggtggccggagacactttggtcatgagaatgacactcacaaagcttcaaaaa
cgctttggaattgcaaagatggatggaaaggcgtatgtgggaggtgaggtggtttgtgag
ggtgagttcttgatggctatgggtagcagcgagtga

DBGET integrated database retrieval system