KEGG   Lactuca sativa (garden lettuce): 111901654Help
Entry
111901654         CDS       T05352                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
lsv  Lactuca sativa (garden lettuce)
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lsv03009]
    111901654
Enzymes [BR:lsv01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     111901654
Ribosome biogenesis [BR:lsv03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    111901654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL Nucleoplasmin Utp14
Motif
Other DBs
NCBI-GeneID: 111901654
NCBI-ProteinID: XP_023753308
LinkDB All DBs
Position
Unknown
AA seq 457 aa AA seqDB search
MAFWGIEIKPGKPHLHQYDDERGRLHLSQATLGSGSSKEKAVVVCNVGDKKPIYLCSLLP
KKMETCSLNIEFEEYDEVTFSVEGPHSIHLSGFFYGEKPDSDDEDDYESDSDEEGIIAPE
MDMDSEDDSDFNFDEADDLTDNEMDMMPNSGVRIEEIVDEENPATEKATPAQSKKNKQGQ
IVVKKSNNVPEVESEDEDGFLILPSDKDKASVPVPESKQVSEVSIGKGQNGQVKRKKGKD
DSEHTAKRKKDDSVTGDDPISQPENVAAVSTPETDAKKSKKKKKNKKVKETQESGDNNKN
VAQKEEINQEKTPVKETKSESKEKSTSTTKKDSKVKTETKASQVRTFPNGLVIEEIQMGK
PNGKRADPGKKISMRYIGKLQKNGKIFDSNIGKAPFKFRLGVGEVIAGWDVGVKGMRVGD
KRRLTIPPAMGYGSKGAGSAIPPNAWLVFDVELIDVN
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcgttttggggaattgaaataaagcccggcaaacctcaccttcatcaatacgacgat
gaaagaggaaggcttcatctatcacaggcaacacttggtagtggttcatctaaagagaag
gctgttgttgtgtgtaatgttggtgataagaaaccgatttacttatgctcgttgctacca
aaaaaaatggagacatgctcactaaacatcgagtttgaggaatatgatgaagttacattc
tcagttgagggacctcacagcattcatctatctggattcttctatggagaaaaaccagat
tctgatgacgaagatgactatgaatctgattctgatgaagaaggtatcatagcaccagag
atggacatggactctgaagatgatagtgattttaattttgatgaagcagatgacctcact
gataatgagatggatatgatgcctaacagtggagtgagaattgaggagattgttgatgaa
gaaaatcctgccactgaaaaagccactcctgcacaatcaaagaagaataaacaggggcaa
attgttgtaaaaaagtcaaacaatgttccagaagtggagagtgaagatgaagatgggttt
ctgatattaccctctgataaggacaaagctagtgttccagttccagagagcaaacaagtt
tcagaagtgtcaattggaaaaggtcaaaatggtcaagtcaagaggaaaaaagggaaagat
gattctgaacatacagcaaaacgaaagaaagatgattctgttacaggagatgatccaatc
agccaaccagaaaatgtagcagcagtttctacaccagaaacagatgccaaaaaatcaaaa
aagaagaagaagaataagaaagtaaaagagacacaagaaagtggtgacaataacaaaaat
gtagctcaaaaggaggaaatcaatcaagagaagacacctgtaaaggagacaaaatcagaa
tccaaagagaagagtacaagtactacaaagaaggattcaaaagtaaaaaccgaaacaaaa
gcatctcaagttagaacttttccaaatggattagtaattgaggagattcaaatgggtaaa
ccaaatggaaaacgggccgacccgggaaagaaaatcagcatgcgttacattgggaagttg
cagaagaatggaaaaatattcgactctaacattggaaaagcaccatttaaatttcgccta
ggtgttggggaagtgatagcgggatgggatgttggtgttaaaggtatgcgtgttggggac
aaaagaagactaaccattcctccagctatggggtatggtagtaaaggtgctggatcagcc
ataccaccaaatgcatggttggtttttgatgttgaattgatagatgtgaattag

DBGET integrated database retrieval system