KEGG   Lactuca sativa (garden lettuce): 111901860Help
Entry
111901860         CDS       T05352                                 

Definition
(RefSeq) alpha-glucosidase-like isoform X1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00052  Galactose metabolism
lsv00500  Starch and sucrose metabolism
lsv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    111901860
   00500 Starch and sucrose metabolism
    111901860
Enzymes [BR:lsv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     111901860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Glyoxalase_3
Motif
Other DBs
NCBI-GeneID: 111901860
NCBI-ProteinID: XP_023753490
LinkDB All DBs
Position
Unknown
AA seq 893 aa AA seqDB search
MATIAVILLILLSIDRKTLADSVKQPEAIGYGYSLRSIALGSSGKSLVADLQLNKKSSLF
GPDIDELKLFASFETTDCLRIRITDAKHQRWEIPTHVLPRQPRTYNFPPKSDQKIPSKLL
LSDPASDLSLTLHNTTTTTTTQFGFTITRRSTGDILFDTSDTVLIFKDQYLELTSSLPAN
RSSIYGIGEHTKRSFKLTHNQTLTLWNADIGSANPDVNLYGSHPYYMDVRSPDSDGKVVA
GTTHGVLLLNSNGMDVQYKGDSITYKVIGGVLDFYFFSGPSPTLVMDQYTRLIGRPTPMP
YWSFGFHQCRWGYKDVDDLESVVAGYAKANIPLEVMWTDIDYMDAYKDFTLDPINFPLDK
MSAFVKTLHQNGQKYVLILDPGISVNTTYETYIRGLKGDIYIKREGIPYVGEVWPGSVNF
PDFLNPKGRIFWGNEINRFHNLLPFDGIWLDMNEESNFISSPPIPTSKLDNPPYKINNSG
TQMPINNKTVPASSLHFGNITAYDAHNLYGFMEARSTKASLVKITGKRPFILSRSTFVGS
GRFTAHWTGDNAATWDDLAYSIPSILNSGLFGIPMVGADICGFSGDTTEELCQRWIQLGA
FYPFARDHSDIQSTRQELYLWDSVAATSRKVLSLRYQMLPYLYMLMYEAHSKGTPIARPL
FFSFPEDTNTYDISTQFLLGKGVLISPVLTPNTVSIDAYFPSGNWFDLFNYSNSVSVESG
SYVTLDSPADHINVHIREGNIIALQREGLTTEIVKESPFHILVAVGGSENSTGEVFLDDG
EELGFGGEGGNWTLVRFSTRFEGKVVILRSEVENGSFALSRKWIIEKLTFIGLENVSGKT
ACDDVGHTGTVKICGVGKFRTVEMMGLSMLIGEGFEFTLDLGGGGGEETRRKL
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgatagcagttatactgttgatattactctcgattgatcggaaaaccctcgct
gattccgttaaacagccggaagcgattggttatgggtactctctccgatctattgcccta
ggttcatcgggaaaatcattggtcgctgatcttcaactcaataagaaatcttcgttgttt
ggacctgacatcgatgagcttaaactcttcgcaagctttgaaacaaccgattgtttgagg
attcgaatcaccgatgctaagcaccaaagatgggaaattccaacccacgtccttccgcgc
caaccacgaacgtacaattttcccccaaaatctgaccaaaaaattccgtcaaaacttctc
ctctcagatcccgcctccgacctcagcttaaccctccacaacaccaccaccaccacaacc
acccaattcggattcacaataacccgtcgttccactggcgatatactcttcgacacatct
gacactgtcctcatcttcaaagatcagtacctcgaactaacatcttcccttcccgctaac
cgatcctccatctacggcatcggagaacataccaagcgttcgttcaaattaacgcacaat
caaaccctaacgctttggaatgctgatatcggaagcgctaaccctgatgtcaatctatat
ggttcacatccttattatatggatgtcagatcgccggattctgatggtaaagtggtggcg
gggactacccacggtgtattgttgctcaatagcaacgggatggatgttcagtataaaggt
gatagtattacgtataaggtaattggaggtgttcttgatttctacttctttagtgggcct
tcgcctacattagtcatggatcagtacactcgtttaatcggacgaccaactcccatgccc
tattggtccttcggattccatcagtgtcgatggggttacaaagatgttgatgatcttgag
agtgttgttgctggatatgcaaaagccaatatcccgctagaggttatgtggacagatata
gactatatggatgcttataaagatttcactttagaccctattaattttcctttggataaa
atgtcagcatttgttaaaactcttcaccaaaatggtcagaaatatgtcctcatattagat
ccaggtatcagcgtgaacacaacatatgaaacttacataagaggactaaaaggcgatatc
tatataaaacgtgaaggaataccgtatgtaggcgaggtttggcctggaagtgttaacttc
ccggattttttaaatccaaaaggaagaatcttttggggcaatgaaatcaatagattccac
aatcttcttccattcgatggaatctggcttgacatgaatgaagaatcaaatttcatttcc
tcccctccaattcccacttcaaaactcgacaaccctccatataaaatcaacaactctgga
acccaaatgcctattaataacaaaaccgttcctgcaagttctttgcattttgggaacatc
actgcttatgatgcacataacttgtatggatttatggaagccaggtcaacaaaggcatct
ttggtcaaaataacaggaaaacggccgtttatactttcgagatcgacgtttgtggggtcc
ggaagatttacagcacattggactggagataatgctgcgacatgggatgacttggcgtat
tccattccgagtattttgaattccgggttatttgggattccgatggtgggggctgatatt
tgtggtttttctggagatactactgaagaactctgccagagatggattcagttgggtgct
ttttacccatttgcaagagaccattccgacatacaaagcacaagacaagagctttacctt
tgggattcagtagcagcaacatctcgaaaagtcctcagccttcgttaccaaatgctccct
tatctctacatgttaatgtacgaagcccattcaaaaggcactcccatcgcacgacctctc
ttcttctcattcccggaagacaccaacacctacgatatcagcacacagtttctcctcgga
aaaggtgtattaatctcccctgttttgaccccaaatacagtttctatcgacgcatacttt
ccatctggaaactggttcgatctattcaactattccaattcggtgagtgtagaatccggg
agttatgtcacactcgattcacctgctgaccatataaacgttcatattcgcgaagggaat
ataatcgcgttgcagagagaaggtttgaccacggaaatagtcaaggagtcgccgtttcac
atactggtggcggttggtgggagtgagaatagcaccggggaggtgtttttggatgatggg
gaggaattagggtttgggggagaaggtgggaactggacattggtgagattttcgacgcga
tttgaggggaaagttgtgattttgagatcggaggtggagaatggaagttttgcgttgagt
cggaagtggattatcgagaagctgacgtttattgggttggaaaatgtttcagggaagact
gcttgtgatgacgtgggacatacaggaacagtgaagatttgtggtgttgggaagttccgt
acggtggagatgatgggtttgtcaatgttgataggtgaagggttcgagttcacgttggac
cttggcggcggcggtggtgaagaaacaagaagaaaattatag

DBGET integrated database retrieval system